SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070328 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070328
Domain Number 1 Region: 4-51
Classification Level Classification E-value
Superfamily RING/U-box 8.99e-17
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070328   Gene: FBgn0026878   Transcript: FBtr0070342
Sequence length 158
Comment pep:known chromosome:BDGP5:X:1937077:1937851:-1 gene:FBgn0026878 transcript:FBtr0070342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRNNVICTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQDAAYFQLYL
DFEEFPESASAQGGSWGGHNRSQGHSSSSSSCSSNNNNSNDNSSSDDYIGIMREYENLLY
ETGVYREEIEYLNQRIGALTVLNAELSKLHECSDSDVD
Download sequence
Identical sequences Q9XZS4
FBpp0070328 FBpp0070328 FBpp0302591 7227.FBpp0070328 FBpp0070328 NP_001259169.1.81976 NP_569969.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]