SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070364 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070364
Domain Number 1 Region: 321-394,541-748
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.69e-82
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000456
Further Details:      
 
Domain Number 2 Region: 198-307
Classification Level Classification E-value
Superfamily SH2 domain 3.77e-33
Family SH2 domain 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070364   Gene: FBgn0000382   Transcript: FBtr0070380
Sequence length 945
Comment pep:known chromosome:BDGP5:X:2002282:2007698:1 gene:FBgn0000382 transcript:FBtr0070380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFNKCLEKLSSSLGNVVNHKLQEKQVYNNNNINNNNNNTLNNNNAYNNQRNFEYERAIQ
AHYGSKGRRSEERERSGKFKASKGRKAKVTPPTETPEAQEPACKNCMTHDELAQIIKGVA
KGADAQRNRDNRLQRRRRPLSAQPSAAASASTSTESLHRLTPSPQASYPATPTSWTATPP
QFPAAFGGASCSNSTLSLLATMRVQLHGYTWFHGNLSGKEAEKLILERGKNGSFLVRESQ
SKPGDFVLSVRTDDKVTHVMIRWQDKKYDVGGGESFGTLSELIDHYKRNPMVETCGTVVH
LRQPFNATRITAAGINARVEQLVKGGFWEEFESLQQDSRDTFSRNEGYKQENRLKNRYRN
ILPYDHTRVKLLDVEHSVAGAEYINANYIRLPTDGDLYNMSSSSESLNSSVPSCPACTAA
QTQRNCSNCQLQNKTCVQCAVKSAILPYSNCATCSRKSDSLSKHKRSESSASSSPSSGSG
SGPGSSGTSGVSSVNGPGTPTNLTSGTAGCLVGLLKRHSNDSSGAVSISMAERERERERE
MFKTYIATQGCLLTQQVNTVTDFWNMVWQENTRVIVMTTKEYERGKEKCARYWPDEGRSE
QFGHARIQCVSENSTSDYTLREFLVSWRDQPARRIFHYHFQVWPDHGVPADPGCVLNFLQ
DVNTRQSHLAQAGEKPGPICVHCSAGIGRTGTFIVIDMILDQIVRNGLDTEIDIQRTIQM
VRSQRSGLVQTEAQYKFVYYAVQHYIQTLIARKRAEEQSLQVGREYTNIKYTGEIGNDSQ
RSPLPPAISSISLVPSKTPLTPTSADLGTGMGLSMGVGMGVGNKHASKQQPPLPVVNCNN
NNNGIGNSGCSNGGGSSTTSSSNGSSNGNINALLGGIGLGLGGNMRKSNFYSDSLKQQQQ
REEQAPAGAGKMQQPAPPLRPRPGILKLLTSPVIFQQNSKTFPKT
Download sequence
Identical sequences L7XAI0
FBpp0070363 FBpp0070363 FBpp0070364 7227.FBpp0070363 NP_477131.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]