SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070624 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070624
Domain Number 1 Region: 695-833
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 9.92e-37
Family XPF/Rad1/Mus81 nuclease 0.00043
Further Details:      
 
Domain Number 2 Region: 856-925
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000000000322
Family Hef domain-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070624   Gene: FBgn0002707   Transcript: FBtr0070656
Sequence length 961
Comment pep:known chromosome:BDGP5:X:4208263:4212834:-1 gene:FBgn0002707 transcript:FBtr0070656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSCAENAAKGTENERPKEVEASADTVPQVEEGVEEYLKRKNMVLLDYEKQMFLDLVEA
DGLLVCAKGLSYDRVVISILKAYSDSGNLVLVINSSDWEEQYYKSKIEPKYVHEVASTAT
ERERVYLEGGLQFISTRILVVDLLKQRIPIELISGIIVLRAHTIIESCQEAFALRLFRQK
NKTGFVKAFSSSPEAFTIGYSHVERTMRNLFVKHLYIWPRFHESVRTVLQPWKIQSIEMH
VPISQNITSIQSHILEIMNFLVQEIKRINRTVDMEAVTVENCVTKSFHKILQAQLDCIWH
QLNSQTKLIVADLKILRSLMISTMYHDAVSAYAFMKRYRSTEYALSNSGWTLLDAAEQIF
KLSRQRVFNGQQEFEPEPCPKWQTLTDLLTKEIPGDMRRSRRSEQQPKVLILCQDARTCH
QLKQYLTQGGPRFLLQQALQHEVPVGKLSDNYAKESQTRSAPPKNVSSNKELRREEVSGS
QPPLAGMDELAQLLSESETEGQHFEESYMLTMTQPVEVGPAAIDIKPDPDVSIFETIPEL
EQFDVTAALASVPHQPYICLQTFKTEREGSMALEHMLEQLQPHYVVMYNMNVTAIRQLEV
FEARRRLPPADRMKVYFLIHARTVEEQAYLTSLRREKAAFEFIIDTKSKMVIPKYQDGKT
DEAFLLLKTYDDEPTDENAKSRQAGGQAPQATKETPKVIVDMREFRSDLPCLIHKRGLEV
LPLTITIGDYILTPDICVERKSISDLIGSLNSGRLYNQCVQMQRHYAKPILLIEFDQNKP
FHLQGKFMLSQQTSMANADIVQKLQLLTLHFPKLRLIWSPSPYATAQLFEELKLGKPEPD
PQTAAALGSDEPTAGEQLHFNSGIYDFLLRLPGVHTRNIHGLLRKGGSLRQLLLRSQKEL
EELLQSQESAKLLYDILHVAHLPEKDEVTGSTALLAASKQFGAGSHNRFRMAAAASRRGR
R
Download sequence
Identical sequences Q24087 T2FFI3
FBpp0070624 NP_001284859.1.81976 NP_525068.1.81976 FBpp0070624 7227.FBpp0070624 FBpp0070624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]