SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070693 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070693
Domain Number 1 Region: 1306-1584
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.51e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000122
Further Details:      
 
Domain Number 2 Region: 900-1099
Classification Level Classification E-value
Superfamily Fibronectin type III 1.02e-23
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 3 Region: 620-793
Classification Level Classification E-value
Superfamily Fibronectin type III 1.96e-18
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 4 Region: 446-613
Classification Level Classification E-value
Superfamily Fibronectin type III 4.1e-16
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 5 Region: 139-248
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000665
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 6 Region: 241-330
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000377
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 7 Region: 338-430
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000466
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 8 Region: 822-893
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000111
Family Fibronectin type III 0.0044
Further Details:      
 
Weak hits

Sequence:  FBpp0070693
Domain Number - Region: 87-154
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00608
Family Fibronectin type III 0.0095
Further Details:      
 
Domain Number - Region: 1110-1160,1206-1235
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0556
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070693   Gene: FBgn0004368   Transcript: FBtr0070725
Sequence length 1767
Comment pep:known chromosome:BDGP5:X:4833165:4848123:1 gene:FBgn0004368 transcript:FBtr0070725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCATRKQQQLRAHHQQQQIQIQTHGRKRQQLQKQRHNHHHYYQNSQQQQKHFVWLVVGI
LTIFLAQHANAADLVINVPNASSNANAFYRIDYSPPFGFPEPNTTIPASDIGKDIKFSRA
LPGTEYNFWLYYTNSTHREQLTWTVNITTAPDPPANLSVQLRSSKSAFITWRPPGSGRYS
GFRIRVLGLTDLPFERSYSLEGNETLQLSAKELTPGGSYQVQAYSVYQGKESVAYTSRNF
TTKPNTPGKFIVWFRNETTLLVLWQPPFPAGIYTHYRVSITPDDAIQSVLYVEREGEPPG
PAQAAFKGLVPGREYNISVQTVSEDETSSVPTTARYLTVPERVLNVTFDEAYTTSSSFRV
RWEPPRTYSEFDAYQVMLSTSRRIFNVPRAANGDSVYFDYPDILEPGRTYEVVVKTIADN
VNSWPASGEVTLRPRPVRSLGGFLDDRSNALHISWEPAETGRQDSYRISYHEQTNASEVP
APFPVAAESQITTNLTEYTLDSLLAGRRYLIAVQALSKGVASNASDITRYTRPAAPLIQE
LRSIDQGLMLSWRSDVNSRQDRYEVHYQRNGTREERTMATNETSLTIHYLHPGSGYEVKV
HAISHGVRSEPHSYFQAVFPKPPQNLTLQTVHTNLVVLHWQAPEGSDFSEYVVRYRTDAS
PWQRISGLHENEARIKDMHYGERYLVQVNTVSFGVESPHPLELNVTMPPQPVSNVVPLVD
SRNLTLEWPRPDGHVDFYTLKWWPTDEEDRVEFKNVTQLEDLSSPSVRIPIEDLSPGRQY
RFEVQASSNGIRSGTTHLSTRTMPLIQSDVFIANAGHEQGQDETITLSYTPTPADSTRFD
IYRFSMGDPTIKDKEKLANDTERKLSFSGLTPGKLYNVTVWTVSGGVASLPVQRLYRLHP
LPISDLKAIQVAAREITLHWTAPAGEYTDFELQYLSADEEAPQLLQNVTKNTEITLQGLR
PYHNYTFTVVVRSGSIQGTDFADVSVSTLMRSSAPISASYQTLTAPPGKVDYFQPSDVQP
GEVTFEWSLEPAEQHGPIDYFRITCQNADDAADVSSYEFPVNATQGKIDGLVPGNHYIFR
IQAKSALGYGAEREHIQTMPILAPPVPEPSVTPLEVSRTSSTIEISFRQGYFSNAHGMVR
SYTIIIAEDVGKNASGLEMPSWQDVQAYTVWLPYQAIEPYNPFLTSNGSRKSSLEAEHFT
IGTANCDKHQAGYCNGPLRAGTTYRIKIRAFTDEDKFTDTVYSSPITTERSDTVIVAATV
SAVLLVAMVLVVVYCQHRCQLIRRASKLARMQDELAALPEGYITPNRPVHVKDFSEHYRI
MSADSDFRFSEEFEELKHVGRDQACSFANLPCNRPKNRFTNILPYDHSRFKLQPVDDDDG
SDYINANYMPGHNSPREFIVTQGPLHSTREEFWRMCWESNSRAIVMLTRCFEKGREKCDQ
YWPVDRVAMFYGDIKVQLIIDTHYHDWSISEFMVSRNCESRIMRHFHFTTWPDFGVPEPP
QSLVRFVRAFRDVIGTDMRPIIVHCSAGVGRSGTFIALDRILQHIHKSDYVDIFGIVFAM
RKERVFMVQTEQQYVCIHQCLLAVLEGKEHLLADSLELHANDGYEVTKIYLERQPQTKMG
TLPIRASLAMAEKLDADLMTNKDEDEDQEQQQQQQLQLATEVKPKGSNDDEEDEEDDDDD
DDDQQPLNNETTATLSSASCSSSTHDVHVVLQEAIEKPKQEQERICAGTQSHADTESDNT
DSDDDDEDGDGKVAKDGAVADEDGWWY
Download sequence
Identical sequences Q9W4F5
FBpp0070692 FBpp0291007 FBpp0291008 FBpp0291010 FBpp0070693 NP_001162669.1.81976 NP_001162670.1.81976 NP_001162672.1.81976 NP_525076.2.81976 FBpp0070692 FBpp0291007 FBpp0291008 FBpp0291010 7227.FBpp0070692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]