SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071225 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071225
Domain Number 1 Region: 43-133
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000299
Family Canonical RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071225   Gene: FBgn0030085   Transcript: FBtr0071288
Sequence length 233
Comment pep:known chromosome:BDGP5:X:8982400:8983347:1 gene:FBgn0030085 transcript:FBtr0071288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVEETKLDEARWGKPQTKEGESANGIANPSNDDKKELANFKATFNSWAPEKKREKMHKV
GVILISNIPKDMDGDCLKEIMNLHSVVGRVYVQPETLSSFKTKKNMRKGWVEFISKSGAK
KIALELNNKPITDGKSSRFRGLLWKMKFLPRFKWYYLTDRMDYELAVCKVRVWSQARKRA
TFWYDPDQMEYFKKQVKKMKKMKKVKEAEMATRNAEMAAKKAEMAAKKLKKSA
Download sequence
Identical sequences Q9W393
NP_572523.1.81976 FBpp0071225 FBpp0071225 7227.FBpp0071225 FBpp0071225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]