SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0072253 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072253
Domain Number 1 Region: 201-292
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.09e-25
Family Canonical RBD 0.0016
Further Details:      
 
Domain Number 2 Region: 108-195
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.3e-25
Family Canonical RBD 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072253   Gene: FBgn0035016   Transcript: FBtr0072346
Sequence length 307
Comment pep:known chromosome:BDGP5:2R:20411228:20413608:-1 gene:FBgn0035016 transcript:FBtr0072346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVNSMTFRGNPANYHQQQPALNHHTLAAAHHQQQLHHHAAAAGHLSHVGGGHAASNHLA
AAAVLGRHGHNSLGSGHTSTSSHSANVGVGVGGGALASGSTGGSGGNSSPDSGKIYIKNL
ERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNN
QKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEG
RSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQK
AGQIFYY
Download sequence
Identical sequences B4IH29 B4QC09 Q9W158
FBpp0072253 FBpp0297274 7227.FBpp0072253 FBpp0072253 NP_001246493.1.81976 NP_611924.1.81976 XP_002043074.1.34323 XP_016029471.1.80810 FBpp0223346 FBpp0193299 FBpp0072253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]