SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072680 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0072680
Domain Number - Region: 53-185
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000523
Family Growth factor receptor domain 0.0026
Further Details:      
 
Domain Number - Region: 562-668
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00612
Family Growth factor receptor domain 0.0026
Further Details:      
 
Domain Number - Region: 402-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0156
Family Laminin-type module 0.089
Further Details:      
 
Domain Number - Region: 535-582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0352
Family Laminin-type module 0.032
Further Details:      
 
Domain Number - Region: 668-713
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family Laminin-type module 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072680   Gene: FBgn0027594   Transcript: FBtr0072798
Sequence length 1031
Comment pep:known chromosome:BDGP5:3L:1715594:1731093:-1 gene:FBgn0027594 transcript:FBtr0072798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPVILIACLAQLVLAQADLKDLDGPNICKRRELYNVDVVYTELQSFQERGSTWCVTFPP
RCSTYRIKHRVVNKTKTIAKNRIVRDCCDGYIASAGECVPHCSEPCQHGRCISPEKCKCD
HGYGGPACDINCPPGWYGRNCSMQCDCLNNAVCEPFSGDCECAKGYTGARCADICPEGFF
GANCSEKCRCENGGKCHHVSGECQCAPGFTGPLCDMRCPDGKHGAQCQQDCPCQNDGKCQ
PETGACMCNPGWTGDVCANKCPVGSYGPGCQESCECYKGAPCHHITGQCECPPGYRGERC
FDECQLNTYGFNCSMTCDCANDAMCDRANGTCICNPGWTGAKCAERICEANKYGLDCNRT
CECDMEHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRYGPNCELTCNCKNGAKCSPVNGT
CLCAPGWRGPTCEESCEPGTFGQDCALRCDCQNGAKCEPETGQCLCTAGWKNIKCDRPCD
LNHFGQDCAKVCDCHNNAACNPQNGSCTCAAGWTGERCERKCDTGKFGHDCAQKCQCDFN
NSLACDATNGRCVCKQDWGGVHCETNCRSGYYGENCDKVCRCLNNSSCDPDSGNCICSAG
WTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITGEILCRTGYIGLTCEHPCPAGLY
GPGCKLKCNCEHGGECNHVTGQCQCLPGWTGSNCNESCPTDTYGQGCAQRCRCVHHKVCR
KADGMCICETGWSGTRCDEVCPEGFYGEHCMNTCACPSANFQCHAAHGCVCRSGYTGDNC
DELIASQRIADQSENSSRASVALTLVLMTLFACIIFAVFIYYRRRVSNLKTEIAHVHYTH
DTNPPSWPPNHNFDNPVYGMQAETRLLPNNMRSKMNNFDQRSTMSTDYGDDCNASGRVGS
YSINYNHDLLTKNLNADRTNPIVYNESLKEEHVYDEIKHKEGYKDPDEYDHLDYSRPSTS
QKPHYHRMNDAMLNINQDEEKPSNVKNMTVLLNKPLPPTEPEPQHECFDNTNTNLDNVST
ASPSSSPKFLK
Download sequence
Identical sequences Q9W0A0
7227.FBpp0072681 FBpp0072681 NP_728660.2.81976 FBpp0072680 FBpp0072681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]