SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072825 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072825
Domain Number 1 Region: 23-332
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.53e-75
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00083
Further Details:      
 
Domain Number 2 Region: 319-431
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.00000000000785
Family Anticodon-binding domain of Class II aaRS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072825   Gene: FBgn0027082   Transcript: FBtr0072948
Sequence length 458
Comment pep:known chromosome:BDGP5:3L:2650161:2651834:-1 gene:FBgn0027082 transcript:FBtr0072948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKASRIFCPALITPKNAVVKQTEQLSRSQKLLTELGLVKSGSNGTYQIMPMAQRSVDKC
IDLVQSNMQQAGGQKITLPILTPTGLWKKTGRLDGDISEFYMVRDRSGKQFLMSPTHEEA
VTAMLATTSPISYRQLPLRLFQIGPKFRDELKTRFGLMRAKEFLMKDMYSFDVSEETAME
TYTLVNAAYDRLFKQLEVPFVKVNAATGIMGGSVSHEYHYVSPVGEDNLLQCSSCGFAGN
SEVVKAPASCPSCNSSDLKEVRGVEVAHTFLLGDKYSKPLGATFLNTTGKPQSLVMGCYG
IGITRVIAAALEVLSSDHELRWPKLLAPYDVCLIGPKQGSKEQPEAEVIENELLLNVGEI
CGHQELLHDDRKELTIGKRLLEAKRLGHPLTIVVGAKSARLDSPKLEVHTSKGETYELDF
SETLKLVAEHSQHKKSLERGCFQSETEESKSRSVGHQL
Download sequence
Identical sequences Q9VZY9
FBpp0072825 FBpp0072825 NP_647737.1.81976 7227.FBpp0072825 FBpp0072825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]