SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073501 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073501
Domain Number 1 Region: 7-192
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.53e-40
Family G proteins 0.0000258
Further Details:      
 
Domain Number 2 Region: 194-232
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000209
Family SOCS box-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073501   Gene: FBgn0030391   Transcript: FBtr0073668
Sequence length 265
Comment pep:known chromosome:BDGP5:X:12353823:12357141:-1 gene:FBgn0030391 transcript:FBtr0073668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTMTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKTTT
ILLEGKRVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEH
APGIPKVLVGNRLHLAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESFCELARMAL
HRNGMEHIWRSNKVLSLQELCCRTIVRRTSVYAIDSLPLPPSVKSTLKSYALTTSQCFNS
LTQSSKSKNRCKTPTSSSRNSCAIA
Download sequence
Identical sequences Q8IR80
FBpp0073502 FBpp0073502 NP_727611.1.81976 FBpp0073501 7227.FBpp0073502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]