SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0074178 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074178
Domain Number 1 Region: 7-82
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000104
Family Canonical RBD 0.014
Further Details:      
 
Weak hits

Sequence:  FBpp0074178
Domain Number - Region: 1067-1193
Classification Level Classification E-value
Superfamily Heme iron utilization protein-like 0.0365
Family HemS/ChuS-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074178   Gene: FBgn0028974   Transcript: FBtr0074404
Sequence length 1370
Comment pep:known chromosome:BDGP5:X:17048143:17053339:-1 gene:FBgn0028974 transcript:FBtr0074404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPRPGGYNYKTLLCRNIPELFLDKYVARSHFGRFGTLVNFVLRPRRMTCTVSYASEDE
AARALLDGASFQGHLFDISYADNETAPAQKTEEWVDPDIQAELSALQSGWRNEYGSGKPI
KKPQNGSSGSGGSSMLPAIPVGPATAPVSRDRTPAQLRDLENMMRRPAHTSEEKFSVLDA
RDKLLRLNRTQHKLSGATQGHCADMCPEKERVLREFQRQVAYYELQPGSDELICHERALK
QYSRSSADQETPLPHELRNETALHMTMSYLMHEIMDISERQDPQSHMGDWFHFVWDRTRS
IRKEITQQELCSLGAVKLVEQCARFHIHCAARLVDADPSVFDSKINAENLTKCLQTLKYM
YHDLRIKGVPCPKEAEFRGYIVLLNLADANFLWDIGQLPAELQSCPEVRQAIQFYLALQD
TNFVRFFQLLADKDTSYLSACILVNYFTRLRVLGLHRLIQAYRSPRKDEVSSLPLSYIAE
LLSFASEQEAADFVQHYGLQINEAGRVVLSRMHTVETEYKLPRQYELVEVKRVKSVGEVV
SGEPLPPRDLYLNHRPHNSFDDYGMLKSIAWTAKDQLAGMQQEEMQPQMPSQPPAVSKHS
DTLFKVPMQPDGTAAGFGVFAAAAVPPASSIDGFSFVLPKSRAQEFQEQAPATQQRRAQE
EAKHQALQVAIAAAKKREAELMAIHEAKVAEAERVRQQKLRERQEQQRRQQQELEEQRQR
EQEKLQLEKERQLKLEQLFFVQQQEREAHKQTRTLELYQEIFQDTLAEICQSEFMSHSRA
CRSYESMLDSITRDLVERQMEQSIYELGVMRVCIRRWRKYRRTQQEKDTLFNQLPLSFGA
ENPEGVVNKRSMEDSLRLSRRYRLGEPCDYGKLLAGLEEHSWLKLDLWHVLDKCLPVAQP
GARRFYKLLISLSGGQEGLQLNCDLDRGLLQQPQSPDARFVDGGYIRGFSQGIGLSVMKI
RDDDHDWKATDLAEANGIICLIGLDDIRLLPDRLKPLLQASRCHDVAVIVQHPANTAFVQ
PDIPLQELCLRSFNIFRLRKSGNNRQRLMIALESAVKFLAKATERKRVGHLHQVETREYL
LVNLGSELFRRLKYAAEHDTAIRSDTQLNPQRCVDLFNEAVHRLQLVAGEDLSDWPQFPE
ELRVFVQPLPIESSLNTNRLEHFEPGWHLPERRQRIVQLLERCKLPKMPVLPRSSSLAEA
QCQWVLDYAQISQQEDCVEQIALQAIKILQYDTDDYLNFVEYLAGERMQYILRQERNPPQ
GIVYNTKTLKRRFLSAWYYEFREPQIYEPVPAEENAQMLEKQPSSQAEVQQLDFDEITSK
AEAVLKRFHQRQDERHTLRELNRSHKSRKRRDASDHKHASKHKRKRSKSK
Download sequence
Identical sequences Q9U3V9
7227.FBpp0074178 FBpp0074178 FBpp0074178 FBpp0074178 NP_728054.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]