SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074365 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074365
Domain Number 1 Region: 82-451
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.99e-70
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000465
Further Details:      
 
Domain Number 2 Region: 464-557
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 5.23e-18
Family Anticodon-binding domain of Class II aaRS 0.005
Further Details:      
 
Weak hits

Sequence:  FBpp0074365
Domain Number - Region: 6-31
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.000981
Family a tRNA synthase domain 0.0051
Further Details:      
 
Domain Number - Region: 41-70
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.0471
Family a tRNA synthase domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074365   Gene: FBgn0027087   Transcript: FBtr0074593
Sequence length 563
Comment pep:known chromosome:BDGP5:X:18409432:18414480:1 gene:FBgn0027087 transcript:FBtr0074593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTREQILEQIKVQGDLVRQLKAAKESKEKHLSNPHHVHVPSLKSFPASPLQIDEEVAR
LLALKATLGGDAAPTNQKFTLKTPKGTRDYGPQQMTLRQGVLDKIVQVFKRHGGEAIDTP
VFELKVSSPGSHWSGMILFKTMRIEVLTGKYGEDSKLIYDLKDQGGEILSMRYDLTVPLA
RYLAMNKISSIKRYHIAKVYRRDNPAMTKGRYREFYQCDFDIAGTYDPMLPDAECVKIVS
EILDTLDIGDYVIKLNHRQLLDGMFQACGVPADSFRTICSAVDKLDKSPWADVRKEMVDE
KGLDEAAADRIGEYVRLSGGAELVEQLLANEKLKAVPNAVKGLEGMKQLLKYCSIFGLDK
RVSFDLSLARGLDYYTGVIYEGVLKGESATVASPAKTSQQNGEQANEPATVGSVAGGGRY
DNLVGMFDPRGKAVPCVGVSIGVERIFSVLEARAAASGLKLRTSDVEVYVASAHKGLHEQ
RLKVLNLLWDAGVKAEHSYKLNPKLLVQLQHCEEHQIPLVVVLGDAELAQGLVKLREVTT
REETNVKLEDLAAEIRRRQQASA
Download sequence
Identical sequences FBpp0074365 7227.FBpp0074366 FBpp0074366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]