SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074515 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074515
Domain Number 1 Region: 130-393
Classification Level Classification E-value
Superfamily NHL repeat 0.0000152
Family NHL repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074515   Gene: FBgn0031052   Transcript: FBtr0074746
Sequence length 2111
Comment pep:known chromosome:BDGP5:X:19546340:19553444:1 gene:FBgn0031052 transcript:FBtr0074746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWHEVELDGSRTIAFPERIVPGFGREPSAHLDAAEYLGGIIRDGQWGWVTWRYGSDATL
LVCSMSTGDYLSWHCFWSESDDLGPRKSIRCVEELFPGEHERPAMLAICLESWNSGDQRP
IDCPLSTQVLIYAIRNSQVLRRFDLHGITCSALTFLDKRIYGLTRLRRFKGCLAVATEEG
TVLLVDLNSDSLQASTQRRSLCSPSSKDEPSDGNLYFVSSEESKRQLSSKLTHCRSKGAH
LAVRMDVASIGISCLMGISMAPGYAAGLEDGRILIYDLINFDVTTDLNSPVKRKGVNRAV
KRMCLIMPPDDPKPCFYICALYQNIDVLQMMLHSVCYRGSYRDRETHTIRFKDYRSRTVR
NRQILDGGICSVIGCATASTFSFAGDNGTLLIVISWHSSADKKNKLVLFDINQWYKDEMP
TSVHKNEVPNYMSGYILSGLQTGLALDLRSTTILHFVSLQRYDEHFYPNSLTFDCSLLTP
TGKRYYAQDGVQHRFLNALRCDRATLFLRPQIYHEDIVRLRLLPQFCELNPNATFSKIAM
YELILSVALEHNCGALLNDCARSWMDGSFLCNMIDNTQLSLSTLTNWILKRAGQIKTRCS
ELCHGIFDYGGYPLDQRERREFQVLSGQLRELVRLQSYIVEQGRRRLTSSILDDCRANER
ALKTVLEYQRVLLWFIDHGLLPEGQHMDNLVPGEQAFVRLQHEYSEKRAQGKILYIDSLG
KRASFPEPYPPDSLHAYIHLMLSPDIELCHKHALILYLLMDLNQQLVGRFQIAFQLDKDL
ATSLRCFWYLDHGDYERGVEELYKEPAPAKNLKSWQMRLLIDKLLAEGAVKAAKKVVSRP
PGPLSSALHMKVLLANENITEAFQIARLDDDEDGQPLLERFFRHCIEIRRFKVLAELYLR
EPEERLLYSLLRQCRSRQTDCVQLIMLLQKSKFIEAVSFMDEVAAERERDESSNTILPAY
SATMGPVTQNIAGTYLRIRDTLEPYQKTGPLEPFSCQLVKQNASGQLGGIFQSSAVSAHW
ATQCESPPKMTPVSIQSKIGYTNVPFLRHAQYGHSELPLPRRIVKPVPHQVVEKRQRELE
DQRTNLQDQRQLGTERPNKRPCLMVERMVEDVKDYVRSIREKSSNQMEQEEVKQNEATNL
LQPPNFLQARQSTTIRQSSSSPQPIPPILKGSGAVDAVKRAPPVATFTALAGPKRFRFVP
PIPLRTDKSDKSTEMGSEGAAEGEEETDEIIVEIESRSEPRSACSYESDEEDEFLSPLVS
ANVSLVDPVPSRNSPHYFAPPAGPQPRNSLLHGGNGSGSKIGTATGSESSSGFGSFSTVQ
PAQTSSHSQFVPTVCSSKMGETQSQVFSSGSCGIKISERTTICGEMESTDLGAELTAAPS
AQWSLPSARPAIQGHHQMMDTTLGMSTYDVASLEQQDTQDVENEEELKLGDTKSLEEQQN
PQDEQKPEQEQDQDEDQAQEPLATGGQLAFLSNSEGTAQEPLSSPIYSLSSEDSNVSSAG
IRNPMLPTLHTDDPMYSIVVESPGSITTSRSVTHTPTSFLPSDTNVSQTSSPQAPHGEDG
DGTPISLYRANSLETVDDLDTTKGSLEEEEEYDDDDCVIALDGTEVRGYVARPQQSAASS
SAELFAFKDECQEEAAGVPSPFLSLGATVNSDSDVADTIVLDSDEETAKEKDTQPEQRKD
WPMEEETPSNESVATVEFSEQKQPRADMDIGMEVDAVPDVLEVLEVPEMEPLPVLSDVDI
EMAVDEVPNVLEVLEVPELEPLPAGQATQSSGLGEIPEEDVDAEAEEQVVVKVEHVADEQ
PKEGDKTESKEASEEETQHNPEPLLPEEEDSRHSLKLIFSGDEDEEEQDVPTRAIHTLRP
RRSFTEHQDSPRTLRPRRVSQEHRDSPTPVAGRTMSLRSTDAPTLSPASNPPVSTPKRRG
LQHKYLLEVIDEHSPSDLSLPRTRSRTRLSVDSEATSSRPGTPTMTKARGKRATSQAPPT
ASPSVRRSLRGHSEPPAALSAQLVRKPKTARAGVRSRKTSSGVQSPVAVSPTPIDAPIDV
PDSTAPEEEQPRLRRTARRRISELSDQSANGTGDLRSEASSSRTGSKSNSAASTQNRELR
PRLRRTSKSEH
Download sequence
Identical sequences Q9VWE6 X2JG50
FBpp0074515 FBpp0074515 7227.FBpp0074515 FBpp0074515 NP_001285454.1.81976 NP_608340.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]