SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075265 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075265
Domain Number 1 Region: 193-315
Classification Level Classification E-value
Superfamily NRDP1 C-terminal domain-like 7.45e-60
Family USP8 interacting domain 0.00000457
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-19
Family RING finger domain, C3HC4 0.03
Further Details:      
 
Domain Number 3 Region: 79-151
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000000981
Family SIAH, seven in absentia homolog 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075265   Gene: FBgn0036546   Transcript: FBtr0075510
Sequence length 315
Comment pep:known chromosome:BDGP5:3L:15949650:15951533:1 gene:FBgn0036546 transcript:FBtr0075510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGYDVNRFQGEVDEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQPTCPVDRNSL
TTANLRAVPRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFPCEKGC
GFDIPKDELKDHNCVRELRTLIVKQTEKMGELKSELTDQQLTINELKRELQLFKDFMRAM
RVSNPAMRAIADQMERDEVIRWSSTLPRARVTRWGGMISTPDDALQLMIKRALSESGCPP
HILDSLMEFCHERRWPRGLSSLETRQTNRRIYDNYVCRRIPGKQAVLVLSCDNLHMTEDV
MIDPGLVMIFAHGIE
Download sequence
Identical sequences Q9VUV7
FBpp0075265 7227.FBpp0075265 FBpp0075265 NP_001261904.1.81976 NP_648816.1.81976 FBpp0075265 FBpp0305750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]