SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076722 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076722
Domain Number 1 Region: 2877-3048
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.15e-32
Family Laminin G-like module 0.00075
Further Details:      
 
Domain Number 2 Region: 3343-3512
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.47e-28
Family Laminin G-like module 0.0038
Further Details:      
 
Domain Number 3 Region: 2672-2856
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.29e-28
Family Laminin G-like module 0.0035
Further Details:      
 
Domain Number 4 Region: 3055-3226
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.49e-27
Family Laminin G-like module 0.0045
Further Details:      
 
Domain Number 5 Region: 3523-3711
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.24e-24
Family Laminin G-like module 0.002
Further Details:      
 
Domain Number 6 Region: 1917-1971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000725
Family Laminin-type module 0.0025
Further Details:      
 
Domain Number 7 Region: 541-589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000112
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 8 Region: 1867-1919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family EGF-type module 0.093
Further Details:      
 
Domain Number 9 Region: 1466-1516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000502
Family Laminin-type module 0.0076
Further Details:      
 
Domain Number 10 Region: 1809-1861
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 11 Region: 495-543
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000012
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 12 Region: 1375-1423
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Laminin-type module 0.0062
Further Details:      
 
Domain Number 13 Region: 732-782
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 14 Region: 632-679
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000697
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number 15 Region: 1514-1562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000106
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 16 Region: 333-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000137
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 17 Region: 1427-1463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000279
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 18 Region: 273-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 19 Region: 1970-2019
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000418
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 20 Region: 448-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000128
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 21 Region: 2017-2066
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000206
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 22 Region: 403-450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.042
Further Details:      
 
Domain Number 23 Region: 677-729
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 24 Region: 785-823
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000469
Family Laminin-type module 0.028
Further Details:      
 
Weak hits

Sequence:  FBpp0076722
Domain Number - Region: 1774-1811
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000112
Family Laminin-type module 0.055
Further Details:      
 
Domain Number - Region: 587-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000123
Family Laminin-type module 0.034
Further Details:      
 
Domain Number - Region: 2064-2111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00128
Family Laminin-type module 0.018
Further Details:      
 
Domain Number - Region: 135-230
Classification Level Classification E-value
Superfamily Sialidases 0.00834
Family Sialidases (neuraminidases) 0.078
Further Details:      
 
Domain Number - Region: 2380-2396,2436-2666
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0209
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076722   Gene: FBgn0002526   Transcript: FBtr0077014
Sequence length 3712
Comment pep:known chromosome:BDGP5:3L:6196931:6211084:-1 gene:FBgn0002526 transcript:FBtr0077014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHGVASIGALLVILAISYCQAELTPPYFNLATGRKIYATATCGQDTDGPELYCKLVGAN
TEHDHIDYSVIQGQVCDYCDPTVPERNHPPENAIDGTEAWWQSPPLSRGMKFNEVNLTIN
FEQEFHVAYLFIRMGNSPRPGLWTLEKSTDYGKTWTPWQHFSDTPADCETYFGKDTYKPI
TRDDDVICTTEYSKIVPLENGEIPVMLLNERPSSTNYFNSTVLQEWTRATNVRIRLLRTK
NLLGHLMSVARQDPTVTRRYFYSIKDISIGGRCMCNGHADTCDVKDPKSPVRILACRCQH
HTCGIQCNECCPGFEQKKWRQNTNARPFNCEPCNCHGHSNECKYDEEVNRKGLSLDIHGH
YDGGGVCQNCQHNTVGINCNKCKPKYYRPKGKHWNETDVCSPCQCDYFFSTGHCEEETGN
CECRAAFQPPSCDSCAYGYYGYPNCRECECNLNGTNGYHCEAESGQQCPCKINFAGAYCK
QCAEGYYGFPECKACECNKIGSITNDCNVTTGECKCLTNFGGDNCERCKHGYFNYPTCSY
CDCDNQGTESEICNKQSGQCICREGFGGPRCDQCLPGFYNYPDCKPCNCSSTGSSAITCD
NTGKCNCLNNFAGKQCTLCTAGYYSYPDCLPCHCDSHGSQGVSCNSDGQCLCQPNFDGRQ
CDSCKEGFYNFPSCEDCNCDPAGVIDKFAGCGSVPVGELCKCKERVTGRICNECKPLYWN
LNISNTEGCEICDCWTDGTISALDTCTSKSGQCPCKPHTQGRRCQECRDGTFDLDSASLF
GCKDCSCDVGGSWQSVCDKISGQCKCHPRITGLACTQPLTTHFFPTLHQFQYEYEDGSLP
SGTQVRYDYDEAAFPGFSSKGYVVFNAIQNDVRNEVNVFKSSLYRIVLRYVNPNAENVTA
TISVTSDNPLEVDQHVKVLLQPTSEPQFVTVAGPLGVKPSAIVLDPGRYVFTTKANKNVM
LDYFVLLPAAYYEAGILTRHISNPCELGNMELCRHYKYASVEVFSPAATPFVIGENSKPT
NPVETYTDPEHLQIVSHVGDIPVLSGSQNELHYIVDVPRSGRYIFVIDYISDRNFPDSYY
INLKLKDNPDSETSVLLYPCLYSTICRTSVNEDGMEKSFYINKEDLQPVIISADIEDGSR
FPIISVTAIPVDQWSIDYINPSPVCVIHDQQCATPKFRSVPDSKKIEFETDHEDRIATNK
PPYASLDERVKLVHLDSQNEATIVIESKVDATKPNLFVILVKYYQPSHPKYQVYYTLTAG
KNQYDGKFDIQHCPSSSGCRGVIRPAGEGSFEIDDEFKFTITTDRSQSVWLDYLVVVPLK
QYNDDLLVEETFDQTKEFIQNCGHDHFHITHNASDFCKKSVFSLTADYNSGALPCNCDYA
GSTSFECHPFGGQCQCKPNVIERTCGACRSRYYGFPDCKPCKCPNSAMCEPTTGECMCPP
NVIGDLCEKCAPNTYGFHQVIGCEECACNPMGIANGNSQCDLFNGTCECRQNIEGRACDV
CSNGYFNFPHCEQCSCHKPGTELEVCDKIDGACFCKKNVVGRDCDQCVDGTYNLQESNPD
GCTTCFCFGKTSRCDSAYLRVYNVSLLKHVSITTPEFHEESIKFDMWPVPADEILLNETT
LKADFTLREVNDERPAYFGVLDYLLNQNNHISAYGGDLAYTLHFTSGFDGKYIVAPDVIL
FSEHNALVHTSYEQPSRNEPFTNRVNIVESNFQTISGKPVSRADFMMVLRDLKVIFIRAN
YWEQTLVTHLSDVYLTLADEDADGTGEYQFLAVERCSCPPGYSGHSCEDCAPGYYRDPSG
PYGGYCIPCECNGHSETCDCATGICSKCQHGTEGDHCERCVSGYYGNATNGTPGDCMICA
CPLPFDSNNFATSCEISESGDQIHCECKPGYTGPRCESCANGFYGEPESIGQVCKPCECS
GNINPEDQGSCDTRTGECLRCLNNTFGAACNLCAPGFYGDAIKLKNCQSCDCDDLGTQTC
DPFVGVCTCHENVIGDRCDRCKPDHYGFESGVGCRACDCGAASNSTQCDPHTGHCACKSG
VTGRQCDRCAVDHWKYEKDGCTPCNCNQGYSRGFGCNPNTGKCQCLPGVIGDRCDACPNR
WVLIKDEGCQECNNCHHALLDVTDRMRYQIDSVLEDFNSVTLAFFTSQKLNYYDQLADEL
EPKVKLLDPNSVDLSPSKKANSELESDAKSYAKQVNQTLANAFDIRERSSTTLGNITVAY
DEAVKSADQAKEAIASVEALSKNLEAAASTKIDAALEQAQHILGQINGTSIELTPNEQVL
EKARKLYEEVNTLVLPIKAQNKSLNALKNDIGEFSDHLEDLFNWSEASQAKSADVERRNV
ANQKAFDNSKFDTVSEQKLQAEKNIKDAGNFLINGDLTLNQINQKLDNLRDALNELNSFN
KNVDEELPVREDQHKEADALTDQAEQKAAELAIKAQDLAAQYTDMTASAEPAIKAATAYS
GIVEAVEAAQKLSQDAISAAGNATDKTDGIEERAHLADTGSTDLLQRARQSLQKVQDDLE
PRLNASAGKVQKISAVNNATEHQLKDINKLIDQLPAESQRDMWKNSNANASDALEILKNV
LEILEPVSVQTPKELEKAHGINRDLDLTNKDVSQANKQLDDVEGSVSKLSELAEDIEEQQ
HRVGSQSRQLGQEIENLKAQVEAARQLANSIKVGVNFKPSTILELKTPEKTKLLATRTNL
STYFRTTEPSGFLLYLGNDNKTAQKNNDFVAVEIVNGYPILTIDLGNGPERITSDKYVAD
GRWYQAVVDRMGPNAKLTIREELPNGDVVEHSKSGYLEGSQNILHVDKNSRLFVGGYPGI
SDFNAPPDLTTNSFSGDIEDLKIGDESVGLWNFVYGDDNDQGARERDVLLEKKKPVTGLR
FKGNGYVQLNATSNLKSRSSIQFSFKADKDTSNGLLFFYGRDKHYMSIEMIDGAIFFNIS
LGEGGGVQSGSQDRYNDNQWHKVQAERENRNGLLKVDDIVISRTNAPLEADLELPKLRRL
YFGGHPRRLNTSISLQPNFDGCIDNVVINQGVVDLTEYVTGGGVEEGCSAKFSTVVSYAP
HEYGFLRMNNVSSDNNLHVVLHFKTTQPNGVLFYAANHDQSSTIGLSLQDGLLKLNSMGS
QLVIDDRILNDGEDHVVTVQHTQGELRLTVDDVDNKRLGSPQPLILEGGDIFFAGLPDNY
RTPRNALASLAYFVGCISDVTVNEEIINFANSAEKKNGNINGCPPHVLAYEPSLVPSYYP
SGDNEVESPWSNADTLPPLKPDIESTLPPTTPTTTTTTTTTTTSTTTTSTTTTTTTPSPI
VIDEEKEIEAKTPQKILTTRPPAKLNLPSDERCKLPEQPNFDVDFTEAGYRFYGLREQRL
QINSLPVKVRRHHDIGISFRTERPNGLLIYAGSKQRDDFIAVYLLDGRVTYEIRVGAQLQ
AKITTEAELNDGTWHTVEVVRTQRKVSLLIDKLEQPGSVDLNAERSAPVLAVELPIYLGG
VNKFLESEVKNLTDFKTEVPYFNGCLKNIKFDAMDLETPPEEFGVVPCSEQVERGLFFNN
QKAFVKIFDHFDVGTEMKISFDFRPRDPNGLLFSVHGKNSYAILELVDNTLYFTVKTDLK
NIVSTNYKLPNNESFCDGKTRNVQAIKSKFVINIAVDFISSNPGVGNEGSVITRTNRPLF
LGGHVAFQRAPGIKTKKSFKGCISKVEVNQRMINITPNMVVGDIWQGYCPLN
Download sequence
Identical sequences NP_476617.1.81976 7227.FBpp0076722 FBpp0076722 FBpp0076722 FBpp0076722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]