SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076871 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076871
Domain Number 1 Region: 13-265
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.49e-90
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000587
Further Details:      
 
Domain Number 2 Region: 266-486
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 8.24e-37
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0005
Further Details:      
 
Domain Number 3 Region: 644-814
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.7e-27
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.053
Further Details:      
 
Domain Number 4 Region: 568-643
Classification Level Classification E-value
Superfamily Translation proteins 0.00000636
Family AlaX-M N-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076871   Gene: FBgn0028962   Transcript: FBtr0077168
Sequence length 1012
Comment pep:known chromosome:BDGP5:3L:5139205:5142954:1 gene:FBgn0028962 transcript:FBtr0077168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYNSAKQLQRVLTAREIRKTFLDHFTVNHGHKFVRSSPVVPFCDPTVAFVNAGMNQFKSV
FLGTAAAPHKRVVNSQKCVRVGGKHNDLSVVGTDGYHHTFFEMLGNWSFGDYFKREACAM
ALELLRGPYNIDPGRLYVTYFAGDKVLGIPADLECFEIWRSLGFPASRILPFGCADNFWE
MGATGPCGPCTEIHIDHRPDLGSVEQRAKLVNAGRSDLTELWNLVFIQYNRHADGSISQL
PAHHVDTGMGFERLTAVLQNKSSNYDTDLFTPIFDGIQQAAKTPVYSGSFPDGGNAAVLD
TSYRILADHARMVTACLADGMLPDQNQKLRRVLRKALNISEHVFAHDKLLTQLVPIVVET
LGEAYPEMAAKQQAVIDLICHEQEVYKNLRESSSKAFAEVLMEFPNLDDIDLMECPGFVP
AYRELQMQRCKFSNNTIPGDFLYKLTDTYGLTEESFLKLAELENMNCDLERYRAEVSLAK
LKAKGNQRETAGGSLCDLATEQRIAEAQAMLTKRLTPTDNSHKYTYSFDKESDSYQIPPL
KTRVLGMLLNDAEVSRTQGSRIQQPFTDLISIVTAGSNFYYESGGQQSDGGKILVSNHQQ
PDHPHSLDVIGVKHLNDCVVHICKLSSPTDAFQLAIGDEVELQVDAQQRQLNTCHHTATH
LLNAAIRSLFKKVTYQVSSSVSSDQCKLELGLLGKRIQKTDVQLIEDLINRVICSAAPVE
VQLLSAAEVLEQNDITMVPGEVYPEQGLRLVNVESPELQLSSKELCCGTHATNTSELSCF
CIVNLKQTNRARFAFTAVAGQAAENVLKTAALLRHRVDLLEKQFQTDKLTNATEAELQTI
RHNMLHTDIKLPYAFKMDTLERITEMLKRIKDSSRTTLKEFVDVEMRTLLQEKPLDTHPF
ILHYITSSALVEEIPLQRATKLCPDRPILVISVCDSVVKARCCVPEKCITEKFNASAWLQ
SFADTFNGQIAAPKGQNPQAVCNMKGRRVSNLFEEQLEQAMSKAHAYAKLYL
Download sequence
Identical sequences Q9VRJ1
NP_523932.2.81976 FBpp0076871 FBpp0076871 FBpp0076871 7227.FBpp0076871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]