SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077155 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077155
Domain Number 1 Region: 140-311
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.86e-22
Family MAM domain 0.007
Further Details:      
 
Domain Number 2 Region: 76-133
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000278
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 3 Region: 26-79
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000612
Family Complement control module/SCR domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077155   Gene: FBgn0020376   Transcript: FBtr0077466
Sequence length 320
Comment pep:known chromosome:BDGP5:2L:4120363:4121442:1 gene:FBgn0020376 transcript:FBtr0077466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVSVEILWALRLFMIYMVIQSIASCEPDILLRNGKVTELSSWLLGDSIKFECNPGFSL
QGKTWHLGNGNMMKRYCAKAGCNDIEKQANGTILTATDGLKAEIECDDEFVLSGNSFTYC
NGTKWIIKLGTCQLANSVGDHSCDFEREDMCGWRASKAIPQPWKRISAAADFLKEKCLQQ
DHTFQSDVEGHFIRLQSQVHASRTYHFISPIYPRNLTVGHSLWFQFELFMFGSEVRNLTI
SVKPSSMAVEDMWNSFRNICTKLTVSGDQGPNWKSQSISIDEMESDFQVVFTVVDPSSLH
GDIGIDDVKFIKSETNEPHS
Download sequence
Identical sequences Q9N2Q3
7227.FBpp0077155 NP_524747.1.81976 FBpp0077155 FBpp0077155 FBpp0077155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]