SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077249 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077249
Domain Number 1 Region: 128-302
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.44e-30
Family MAM domain 0.0026
Further Details:      
 
Domain Number 2 Region: 333-381
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000654
Family Somatomedin B domain 0.0022
Further Details:      
 
Domain Number 3 Region: 66-122
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000001
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 4 Region: 30-82
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000945
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077249   Gene: FBgn0031547   Transcript: FBtr0077560
Sequence length 406
Comment pep:known chromosome:BDGP5:2L:3522594:3523960:-1 gene:FBgn0031547 transcript:FBtr0077560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILLWAIVLISSVDRTNARCLESVHLEHGSTEIVNGSIIFHCDQGYFLQGSKVFTCDRGI
PRGKKPFCAKSGCQEYEQIQNGFVLNAPMKAKIICSDGHGLVGNRIAYCDGEKWSTQLGS
CALRRQTIDVSCDFESEDMCGWTAELSFLGTWKRVSTVADFHSEKTGPQKDHTFQNQSIG
HYVRMETESDAFGTYHFLSPLYPKELSLSGACFQFHYFMFGSGVGSLLVSIKPVSVTIGD
IFKTNHPYKFDQFVMTGSQGARWLEHTIDINKMDEDFQVIFTATDARSQYGDIAIDDVKL
MAAKECARRSTFIEEPKKPIEESDITDSLGYQMTDCSGRCGQDFVRGRYINEGCRCQESC
LVNGNCCLNYVKECHKDLVIAPYNELKFWRLWNLWSGDSNVTVVPK
Download sequence
Identical sequences Q9VQS2
FBpp0077249 NP_608789.1.81976 FBpp0077249 FBpp0077249 7227.FBpp0077249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]