SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077351 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077351
Domain Number 1 Region: 163-462
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.85e-77
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000396
Further Details:      
 
Domain Number 2 Region: 3-72,102-146
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0000000199
Family Seryl-tRNA synthetase (SerRS) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077351   Gene: FBgn0031497   Transcript: FBtr0077667
Sequence length 501
Comment pep:known chromosome:BDGP5:2L:3035493:3037403:-1 gene:FBgn0031497 transcript:FBtr0077667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLDLDLFRSDKGGNPDLVRENQKKRFKDVALVETVIAKDTEWRQCRHRADNLNKVKNVC
SKVIGEKMKKKEPVGAMSEDLPADVTKDLTEIVAETLQPLTVNQIKQLRVLIDDAMTENQ
KSLELAEQTRNTSLREVGNHLHESVPVSNDEDENRVERTFGDCEKRGKYSHVDLIVMIDG
MNAEKGAVVSGGRGYFLTGAAVFLEQALIQHALHLLYARDYVPLYTPFFMRKEVMQEVAQ
LSQFDEELYKVVGKGSEKAEEVGIDEKYLIATSEQPIAAYHRDEWLPESSLPIKYAGLST
CFRQEVGSHGRDTRGIFRVHQFEKVEQFVLTSPHDNKSWEMMDEMIGNAEQFCQSLGIPY
RVVNIVSGALNHAASKKLDLEAWFGGSGAYRELVSCSNCLDYQARRLLVRFGQTKKMNAA
VDYVHMLNATMCAATRVICAILETHQTETGIKVPEPLKKYMPAKFQDEIPFVKPAPIDLE
LAAAEKQKGKKEKTKKDPAAG
Download sequence
Identical sequences Q9VQL1
7227.FBpp0077351 NP_001259982.1.81976 NP_608743.2.81976 FBpp0077351 FBpp0077351 FBpp0077351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]