SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077631 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077631
Domain Number 1 Region: 258-347,385-454
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000112
Family Canonical RBD 0.0068
Further Details:      
 
Weak hits

Sequence:  FBpp0077631
Domain Number - Region: 338-367
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000141
Family Ran binding protein zinc finger-like 0.0048
Further Details:      
 
Domain Number - Region: 834-883
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00555
Family Plant C2H2 finger (QALGGH zinc finger) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077631   Gene: FBgn0031318   Transcript: FBtr0077966
Sequence length 1004
Comment pep:known chromosome:BDGP5:2L:1173011:1177496:1 gene:FBgn0031318 transcript:FBtr0077966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSSRRSFSGGSENEGGRGSDYYRSRPGSRYSRSRSRSRERNRSHGGIRHRNSRSRSRD
RDRSPVFRNDQHRGGRGGAGNGDPDLYHSLINDDYRDQDERNYNSRSNFENRQFRRHDSF
DRRHRDRDGESDRELNDYEYEQRSRDLDSRDRSSTDRDWYHNRSRSREHSRPWNRNNNHD
DRSRSNERNTRHRDHRMYNGGGSNHNRDRDRDRDREQDRERDRDRDRDRERRGSSDYDSD
EGHMRRNKYRSTTEALNIIIIFGLTKEMTRADIMSELIKVNMEPACIRIIRKQGTDSSRG
IAFVEFNTVEEAKQWMDITQGVLKLNDERVSMRYSHKRIQDWNCNKCGVCNFKFRFYCFV
CKTSREDSETTFSSGSEGVDEVSTILTKKIMLRNLDALTNEEAVLTALQLHLKDLSKTVS
KVLISRDSLTQASRGICYLHFDTLVDSMNVHNALTALDPPLTLDDRVVAITYCIDLEEQQ
ALPKNPKELAVKDSTVNSGNISAVSPSGLGGNYTLADVPRLAEYSASLYASNPAEHAYYV
QYYTEYYTADINKNNRDSHLTEANSGAAVALSAIQRKQKKMSSIETTITAAATAAAQAAA
QVKATLAAQVASAPKGNDGKIYPTPDVTQYQYDETSGYYYDSTTGLYYNAHSQYYYNNET
GAYLYWDQRRSTYVLATPASTQAALQEVLADAEQKGEEESKKAKEKEGGNKHDKVKVAKK
IVKDMEKWAKQLNQKKDYTAVATPQPILANEVATTSRGNQGGYADVGFSILEKKERGKLN
DYAPNPTVGPMNKLVNAYGGTSDSEEDNAASSQNTQSSAVVSGGGGAEESDYVDFHKLTC
LLCKRAFQSLEILQKHLKMSTLHKENLAKLNQNTSSSIEEALAYRDRAKERRLKYGESDP
PPPNRSRERFEQEIKTLQSRQKQSTSATPAMPISSSNVGSRLLQKMGWSEGQGLGRKNQG
RTQIIEADGRSNYVGLGNKSGQMIPGNDYKSYIKKMMKQRYENA
Download sequence
Identical sequences Q9VPY4
FBpp0077631 NP_001259859.1.81976 NP_608582.2.81976 FBpp0077631 FBpp0303724 7227.FBpp0077631 FBpp0077631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]