SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0077635 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077635
Domain Number 1 Region: 231-322,360-429
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.23e-18
Family Canonical RBD 0.0071
Further Details:      
 
Domain Number 2 Region: 313-342
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000286
Family Ran binding protein zinc finger-like 0.004
Further Details:      
 
Weak hits

Sequence:  FBpp0077635
Domain Number - Region: 796-836
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0436
Family Classic zinc finger, C2H2 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077635   Gene: FBgn0031319   Transcript: FBtr0077970
Sequence length 968
Comment pep:known chromosome:BDGP5:2L:1177706:1182454:1 gene:FBgn0031319 transcript:FBtr0077970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKGQITNTAFNYNRFALDMDSRYGHSFSGGNGNGSESGYRRYSRSRSRSRERSRDRNEY
RRRNSRSRSRERSSHYRNDRSPDRDLYRDLINEDYEDQGNYNSRQNLDQRHGEDKYDRRH
ADSQGRRDHDSNYDKSGQDMDKDRDHRWKNYDRVSRERNHDDFDRGSERSSRSNDQRQFN
NNGNSNSSSSYRDREKERDRDRRCSSDEDSDMASEFRQRGAYNSGSSVEPLNNIILFGLK
KHVTEADIMGELIKVDLEPTSIRVMRKQQTGASRCFAFVEFKTVEEATRWMELTQGVLQL
GDHRVTMQYSHTRISDWTCIKCGASNFKRRFQCYMCNASRAESENALYGAGEGVDEISQI
LTKKIMLRGLDALTNEEGVLTALQQRLPELAKTVSKVLVSRDALTNASRGICYLNFDTLI
DSMNVFNGLTALDPPLTLDDKTVIVTYCIDSENRQMMPAEGNFFRAGETAMSPSAITAAY
TLADVPRLAEYSASVYASNPLEHANYVQYYTDYYTTEISKNCRDRQVTEANSGAAVALSA
IQRKQRKVSQMETTVSVTEAKVAFLARGESAPKGNDGKKYDTPDVSKYQYDETSGYYYDH
VTGLYYDAHSQYYYNNETGAYLYWDQKRSTYVLATPASTQAALKEVLADAEKKEEEAKKA
KEKEKEKEEAGGKPDKVKVAKKIVKDMEKWAKQLNQKKDYTAVATPQPILSDTEAATTSR
ASQGAYADVGFSILEKKELGKLNDYVPEAGPPAISKLVGAYGGPSDSEDDNSANQKALEA
SVGTKRAISDESDYVDFQKLTCLLCMRAFQSLDILQKHLKMSNLHKENLDKLKRNPAVEA
GTDEGLSYRDRAKERRLKYGESDPPPPNRSRERFEQEIKTLQSRQKDSFGATAAMPISST
NVGSRLMQKMGWSEGQGLGKKNQGRTEIIEADGRSNNVGLGNNTGHMAPGNDYKSYIKKM
MKQRYENA
Download sequence
Identical sequences FBpp0077635 FBpp0077635 7227.FBpp0077635 FBpp0077635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]