SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077683 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077683
Domain Number 1 Region: 8-143
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.89e-22
Family Galectin (animal S-lectin) 0.0058
Further Details:      
 
Domain Number 2 Region: 163-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.31e-17
Family Galectin (animal S-lectin) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077683   Gene: FBgn0031289   Transcript: FBtr0078018
Sequence length 316
Comment pep:known chromosome:BDGP5:2L:860309:861806:1 gene:FBgn0031289 transcript:FBtr0078018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVWKAKVLTEVPFGHVLIVSGRVKPHPNKISLDLTDNVNAQNESETVFLKIEANFREGQ
IIRSMFQPGGGWQQEEISKNWKCDGPKNPLQPGQSFTFRVAVLQRCFEIYVNDQLYGSFE
FVKFPKQINYVRTYGDFEKITQFHHRMLFPLVFPRTLMCPDKVAFQSDVPRRYETGTVVA
MECIAKGPPTTEFSICFQCNDTGRTVLRFHVNFDRTTVSRSYQREDNSFALSDEETEGEF
PFVRGKLFKIAFGLGDRAFLIAVNGQYFTYYNFPGRPFSISTLKCFTNEVGDFAVRSLEY
HSDSPLLARVEKLSII
Download sequence
Identical sequences Q9VPU6
FBpp0077683 FBpp0077683 FBpp0077683 7227.FBpp0077683 NP_001334728.1.81976 NP_608553.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]