SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078512 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0078512
Domain Number - Region: 166-238
Classification Level Classification E-value
Superfamily PH domain-like 0.00676
Family TFIIH domain 0.059
Further Details:      
 
Domain Number - Region: 259-332
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0523
Family Apolipoprotein A-I 0.019
Further Details:      
 
Domain Number - Region: 49-104
Classification Level Classification E-value
Superfamily PH domain-like 0.0584
Family VPS36 N-terminal domain-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078512   Gene: FBgn0037280   Transcript: FBtr0078872
Sequence length 381
Comment pep:known chromosome:BDGP5:3R:642056:643498:1 gene:FBgn0037280 transcript:FBtr0078872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKSLAPIEGNQQPVLQLLWEDKEVKFDVPQLHKNLRSGERVLDYIYHIEDSKGNPGDTG
RLMVTNLRIIWHSLVHKKYNLSIGYARIGNTNTRVVHMHSKARIASQALYILAVSNETRF
EFLFTDVSGETSRRDQPIFASVFDVYHLYQRTYLYRDLKLRGAIVQAGQLVILPDEEVFS
HVQGVWNLSSDQGNLGSFVVTNIRLVWFADANETFNISLPYLQIESLRVRESKYGPALVI
QTAETGGGYVLGFRVDPAERLNELFKELSSLHTVYGEHPNFGIQYNANDARRRLEAASEE
AAQASQIKVDNFEELDERQEREINTKLNSYLAEGCLGKVPSQGERAPVYCKELGFAMEPI
GDGYKLQDLWNVMPTKMETME
Download sequence
Identical sequences Q9I7P3
7227.FBpp0078512 FBpp0078512 FBpp0078512 FBpp0078512 NP_649499.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]