SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078644 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078644
Domain Number 1 Region: 51-248
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-47
Family SPRY domain 0.00037
Further Details:      
 
Weak hits

Sequence:  FBpp0078644
Domain Number - Region: 238-273
Classification Level Classification E-value
Superfamily SOCS box-like 0.000314
Family SOCS box-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078644   Gene: FBgn0260470   Transcript: FBtr0079005
Sequence length 301
Comment pep:known chromosome:BDGP5:2L:5038053:5040818:1 gene:FBgn0260470 transcript:FBtr0079005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDVEVDPQQAHPHPIAAIAPRRRRPTGRRGGVTGGLSSGSLDASSSTSPPPRFCPLPNG
VEDNWTWSKRHRSKEVVLRGPNSRTVHFHPNWSKGTAGVQGKRSLNNGRHYWELHVSQRV
FGTSIMFGIGTKSARLHANAFRNMLGENEHGWGLSHKGVLWHEGVALLYTKRFRENQPTQ
IGVLFDGIEGTLTFYKDGKCLGVAFRGLDQIDEPLYPIVCSTAAKTEMTLKCTRREFVNL
QDRCRAVIMRRVRSAAQLEKLKLPLPIADYLSEVIDEKKPLRQVNQLEMCIMNYDLYEAR
E
Download sequence
Identical sequences Q9VMV3
FBpp0078643 FBpp0305714 FBpp0078643 7227.FBpp0078643 FBpp0078644 NP_001260073.1.81976 NP_723047.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]