SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079014 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079014
Domain Number 1 Region: 2609-2677
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000018
Family IBR domain 0.00088
Further Details:      
 
Domain Number 2 Region: 2522-2578
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000812
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Weak hits

Sequence:  FBpp0079014
Domain Number - Region: 734-759
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000267
Family Ran binding protein zinc finger-like 0.0036
Further Details:      
 
Domain Number - Region: 90-131
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00247
Family B-box zinc-binding domain 0.0038
Further Details:      
 
Domain Number - Region: 2694-2784
Classification Level Classification E-value
Superfamily RING/U-box 0.0102
Family RING finger domain, C3HC4 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079014   Gene: FBgn0031857   Transcript: FBtr0079386
Sequence length 2922
Comment pep:known chromosome:BDGP5:2L:6760527:6770949:-1 gene:FBgn0031857 transcript:FBtr0079386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTHQLLNKNVRTMPSWVMEANDRIGPKPPPTPPNGVAGGLPKAPALPPKAKSTPEPDYE
IIEFSSQQYSNEPMKTTVIRTKTPDNKLKCTLCGSQNPWVTCAECAGQIFCASCDDMFHK
HPKRKQHMRKAVEQGTPPIPPKAQAGGGAPPPVAPPRRSKRGLLTPFLGRKDQMLPPPSP
TPSHKSLGGWRGSLGGGATPPVPPIATSSANQMNNRPLPDPPRSEGGGSSRSGTPKSVFD
TIQRPPSVQLEKIKSKASATLDRMAILQQRYRQQKARQDLSANSEQHLSNEAGFEHWSNI
SPSPSHFRSGSMSSGLNSSHFDLSDDSQFHNSLLLQQRQAAGAQRRQMSTSVFNLNSNPR
RPLSEAQNGGAWLANQRIQQAQSLAQLNCAGCQQSQQHPGWAQHPHQALPQHQHPDQWSQ
FGSQQQFNNSNLSLNVGPGYMSQQHHPHYPPPVFMTQRGMMPNVYPGAPGYPMMHPGVMG
MPPSAASRAASRSRYAASPTPSRKSMSLRRKRNSYVDDELTDDEDSDQDDRRSLVSNRSG
MTSASRSQHHQNHIQPRQRRLSSASQLIASDELDGDQVHHKMRNRRGSIAKSVQSEWLPE
RRENEGTLTRNKTATDSARTSRIYSDLESEGSGARALVQAKIQQKLQEADQHKSSKKAEP
KRKPEMKDENTQAAAVVQKVVVPPAHEESASEYEEVVEEVTASESEAEAQTAPDPQEVPD
EIGADDLGPPPSTPDHEWECEFCTFVNEPNIKICSICCKTPSKPPVQPNKAKKVEEKPQP
PAEKSNNIKASSKTETKPVQKPTTKSQQPSQKSVAALSKTTHTNSTSSSKASPAVNSKTT
SSIPIKTPSKSTLKTSSENESDNSLAKSLLHKANALIRIVPESVENIWNTLDESIQAQAE
QVLKKAQKVSTACGGTPPREIAAVEMGTSPPPQSISTQTYDALPFNTKQEEIIPVVPDRF
TTPEPNKMERRPHYRSNSQLQQESERYRSANDLRYHDGFGLDPYSAGLVTKRPNFINELR
MLQLQVSSPFDMPHETFGVKHEPARDPETEMHIILKELELYKFTVEELEAALKYCSPETH
PIQWLRENWHKLVQTVQSLSTKYGQERGENTIGTVSQNEAREALRNSGGNVWQAVADCIQ
QRQQKYRKLAAKGNFLRDDIVNALTAHQGNVEQALVELNRTQLKPFLMRIWGSPNGVENE
SGVAIDTKSDIHDFLNTHALDCLQPPLAGQSPSPAQANPFDQPRTDESPVKSTYATPSPY
QMEDSTLKNLEILIGNMEQNQAKQNQEVLRSIETMLDTFKGKPELEYETDPEIMRILTKS
PISTMKPSGPAEDKSTDDVKNFVWQHIQEIVPNLVQQVEQELMEKPEEVAKIEAEQPKEP
EPLLEPQPEPTPSVDPAVYIMEEVIKPNLREASIREEVQPSFIYATEIANFKLEFDRGTE
RWHEAEWESSDLTDAERIVYKCYMAPNEQPKEDVVDVAVESSVNSLPTAKAQEESAPEVP
IEAQKIENTEVTQPETVNEELRQQEKLETPLVITSETISETVSQTANESDKQKSIENNLQ
IKQNVAEVQVQSDDQPSTSRDANRRAKRSQQSRKGRSREQSQKPTNRTKLPNNIDQKVNE
SKTAAKETEAVKDKDLSAAASNIQSDVTASDPKTSTPLKILSEGTNSNTLETMENVTSTD
INDNVTIEVISNRSEEVPAIQDLGKTKDISEPTANPIEEITSIQNSTTISEQSEGPQEPE
IPIEVSETTEALQVPREEASIEIVSPPNEEQTKSPTSQEVNIQDTSHIISLPITDVTPTP
EIINIAPSTSSISKEQKQSPKRLSKIPVRTLSSSSLRSESRSSNRTPTANDEIEREETTS
QGVPIGETVSSPKSEQLSDNQEVNLVSQETQSKKDTNIVEEPATQPLGLELEEHSPNATA
VAVSPTDSDEVFEDAPEFSGSDGTRPHDETASDAELYSLDSDGQRAETKSPEDEVVILLD
EESQMESSIAQSESNASLDSHSSESETSKVVLKEFVPSGDPAKQNLSELVEDTQRLIKQM
RDEISMDEFESTDEDEYSDEYSDEYDEGEEEEWYDSEGEEEGDFDGEEGNTYNEHASYIE
EASTGDEGTEIEDIMEEDEDLADDDEPLQSQIPLDIEPVISPALSVTPTNQETDTIAHTE
VVSSTGTRLETELPNPAMESILPSQSVQEDIKVEAIPIQSAPPIADSETRPAEQPVELVL
EIPSEVEPTPVEEPTALPITPAPPIVDSESRPVEPPVETVLEEPKKVTPSMKGKTANSGT
ASKGPSTSSSTKTNKSTVSKIPKPTNEPTNKSNSTPLNKKVPLRSKSFSAPMGISSVKRI
QEVYLQKQSSSIATSRVPLKSSPVTKKSINDAISRFNSNQADGPSTSGAAAAAAAALLKP
RSQPRIPKKKYHETCFSDDDYETSATEEEQEEPNLAEPQKAEQLKRKMSMPVFRAYPSVQ
EPVIEDPAILARKYVDQELVTNIAEAQIAATLVSMKFSEDVALWAARECSDLDQAIAMLQ
QECELCMNSYPMNQMVSMLKCLHKCCKQCAKSYFTVQITDRSINDCSCPFCKLPELSNEA
QHEDEHLEYFSNLDIFLKSILDNDVHELFQRKLRDRSLLQDPNFKWCIQCSSGFFARPKQ
KRLICPDCGSVTCAQCRKPWERQHEGSSCEAYLEWKRENDPELQAQGVQEHLAQNGIDCP
KCKFRYSLARYVQIQKYQYVVSFTSSMFNLYRGGCMHFTCTQCKFEFCYGCARPFMMGAK
CTVSTYCAKLGLHAHHPRNCLFYLRDKIPLQLQFLLKEQNVKFDTEPMQIKDESSSSSKA
RAQARCPIPLQKETPQGLVDTVCNTEVPDKHAGMCRTHYVEYLAGKVAKAGIDPLPIFDL
TDCVQELRRRGIALPERGPWDTDEIYKNMCSEVGVGYHQLMA
Download sequence
Identical sequences FBpp0079014 FBpp0079014 7227.FBpp0079014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]