SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079083 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079083
Domain Number 1 Region: 11-142
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 1.19e-25
Family Insect pheromone/odorant-binding proteins 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079083   Gene: FBgn0011283   Transcript: FBtr0079455
Sequence length 143
Comment pep:known chromosome:BDGP5:2L:7496785:7497360:-1 gene:FBgn0011283 transcript:FBtr0079455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSTPIILVAIVLLGAALVRAFDEKEALAKLMESAESCMPEVGATDADLQEMVKKQPAST
YAGKCLRACVMKNIGILDANGKLDTEAGHEKAKQYTGNDPAKLKIALEIGDTCAAITVPD
DHCEAAEAYGTCFRGEAKKHGLL
Download sequence
Identical sequences P54195
FBpp0079083 NP_523505.1.81976 7227.FBpp0079083 FBpp0079083 FBpp0079083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]