SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080068 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0080068
Domain Number - Region: 156-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0739
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080068   Gene: FBgn0051849   Transcript: FBtr0080490
Sequence length 487
Comment pep:known chromosome:BDGP5:2L:13180397:13182593:-1 gene:FBgn0051849 transcript:FBtr0080490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRSTFLATYNQTPVAGVGRLAITKKLVLWLVLVLQVGFIGCIWLLQMSRGQESQQRSAM
DQLGGRVNFVASGEAPMEKMALVGGTHCPHLQENVNRYDKDFYQMKPERLNESHLPDYNV
PAYVDAEMGLTPNLWCYREGTINESQRLNDVDYLMAPPQCRCESGWHGRDCGQPEIIWRA
LMTSNRASKRGGSTPLQLVEASSSSLHRLFYMLELGAWDHLSLELLELQIRALIEVVDYF
LIYYVSNGSKERSLESMLGSQTSYTLLRCSSESNCTSSMAYSHFRRQLWQQCGVQMQAQD
LLLHGDSGTVYAPAALKFLKYYAKDVLPLKFRLKYNVYGFYWQHPKKTLLNGVISSLGHL
HSAQLDAHRLHRLASSTLGDLNHYGGWNCELCLPPEQIVLLLQSSSPRKLPVKLPNDTRN
AHIDANYMQQLIANGVHIDGTTQLHRLREQSEKYFAPEEALQHSSQYGQLLVNLYDVDVL
EDLQDED
Download sequence
Identical sequences Q95RF3
NP_723787.1.81976 7227.FBpp0080068 FBpp0080068 FBpp0080068 FBpp0080068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]