SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080156 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080156
Domain Number 1 Region: 193-320
Classification Level Classification E-value
Superfamily NRDP1 C-terminal domain-like 1.83e-56
Family USP8 interacting domain 0.0000659
Further Details:      
 
Domain Number 2 Region: 7-87
Classification Level Classification E-value
Superfamily RING/U-box 2.36e-18
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Domain Number 3 Region: 79-135
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000216
Family SIAH, seven in absentia homolog 0.009
Further Details:      
 
Weak hits

Sequence:  FBpp0080156
Domain Number - Region: 137-200
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0301
Family C-terminal domain of PLC-beta 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080156   Gene: FBgn0028847   Transcript: FBtr0080579
Sequence length 328
Comment pep:known chromosome:BDGP5:2L:13722170:13723642:-1 gene:FBgn0028847 transcript:FBtr0080579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQICPVDRSGL
LTSHLVPVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAACEHNPKVVVECSKGC
GMKVPKDEMSRHNCVFELRELVEKLAKEVSDLKQKQSDMEEQSSSQRREMELFQYYIAAL
RSTNPMLRNIGEQLDRFSLMQWGHGLPLANIHTWGSLISTPDNPMHLMVRDVLRESGCPM
HMLNMLVERCHEDRWPEGLMTLDDRRENQHLMSRYVTRLVPGLVIGKPCVVVLGGENTHM
PENLRPILGLVMIFVDGVNEVIFGEEII
Download sequence
Identical sequences Q9VJW5
FBpp0080156 FBpp0080156 FBpp0080156 7227.FBpp0080156 NP_001285905.1.81976 NP_609668.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]