SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080551 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080551
Domain Number 1 Region: 420-533
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 8.24e-21
Family Mannose 6-phosphate receptor domain 0.0051
Further Details:      
 
Domain Number 2 Region: 203-290
Classification Level Classification E-value
Superfamily EF-hand 0.00000251
Family Calmodulin-like 0.055
Further Details:      
 
Domain Number 3 Region: 83-122
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000209
Family LDL receptor-like module 0.0046
Further Details:      
 
Domain Number 4 Region: 45-81
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000654
Family LDL receptor-like module 0.0038
Further Details:      
 
Weak hits

Sequence:  FBpp0080551
Domain Number - Region: 389-420
Classification Level Classification E-value
Superfamily Oligomerization domain of hepatitis delta antigen 0.0745
Family Oligomerization domain of hepatitis delta antigen 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080551   Gene: FBgn0032643   Transcript: FBtr0080998
Sequence length 548
Comment pep:known chromosome:BDGP5:2L:17481988:17484302:-1 gene:FBgn0032643 transcript:FBtr0080998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSLQLSQVLLIPLLLALVATNVGSASEVPRPLGVPLAKASLYQPRAGENSWTCLDGSRT
IPFSHINDDYCDCADGSDEPGTAACPQGQFHCVNKGHQPVNIPSSQVQDGICDCCDGSDE
SETVGCPNTCLELGAAAAVQRRNAAELHKRGAERRQEMITRGKQMRAEREARRLELDQRR
KEQELLRAEKEQLKQTAEALEAEAIEIFKEQQREVDADTAQAEREPQQMRQEATLTFVRY
DTNKDGFVEVTELMVDMNLDRDRNGVVTVEEAKYFLDERERVDLDAFVTLAWPRIKSLQM
LAEGLFQPPQPEEVAQQPEVTTESIQPTPPKLSEEQAELAGDDDIEADEEGEEDQYDDEE
PDVGVGEASPDAEEATPPNYDPETQRLIQQANEARNALEEVERSLREIQQEVNEIDDQNN
KGYGLTEEWAVHDGQCYNFEDREYVYTLCPFDRASQKSRSGGPETTLGRWDKWSGEPKQY
SQQKYTNGAACWNGPNRSAIINISCALEPKITAVSEPNRCEYYFEFETPAACDSEAFQSE
SENLHDEL
Download sequence
Identical sequences Q9VJD1
FBpp0080551 7227.FBpp0080551 FBpp0080551 NP_001246063.1.81976 NP_609844.1.81976 FBpp0080551 FBpp0296964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]