SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081059 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081059
Domain Number 1 Region: 39-82
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000033
Family LDL receptor-like module 0.0039
Further Details:      
 
Weak hits

Sequence:  FBpp0081059
Domain Number - Region: 143-176
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000382
Family Complement control module/SCR domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081059   Gene: FBgn0051544   Transcript: FBtr0081532
Sequence length 263
Comment pep:known chromosome:BDGP5:3R:3244720:3245854:1 gene:FBgn0051544 transcript:FBtr0081532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIRIVRNATKRPARSIRALMEAATRKSRVVMDCQDVSDEANCPISQCPSGTFRCAYVGC
LAKTKACDGEINWWEKSDEVYDICAQKLGKLVAATLTEAPNGTNRTTRMVSVNEIDAHRI
FTRQTSSFSRKFRKPETPSADCTVVRLSCSDNTQLYGSDLNLCLNRKWQGSWSDCKSQCH
RKICTRDPSIRSACHYNRDTADCTHKSSKLFTGTLANMTFAPGYKPKEKTSWQTRTCVEH
PNHQFGFLKRNKIAATAFPNVAL
Download sequence
Identical sequences 7227.FBpp0081059 FBpp0081059 FBpp0081059 FBpp0081059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]