SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081098 from Drosophila melanogaster 69_5

(show help)
Strong hits

Sequence:	FBpp0081098
Domain Number 1	Region: 36-66
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000000511
Family	LDL receptor-like module	0.0027
Further Details:

Domain Number 2	Region: 154-214
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.0000175
Family	Complement control module/SCR domain	0.006
Further Details:

Domain Number 3	Region: 11-41
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000497
Family	LDL receptor-like module	0.0033
Further Details:

Weak hits

Sequence:	FBpp0081098
Domain Number -	Region: 94-146
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.000197
Family	Complement control module/SCR domain	0.0051
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: FBpp0081098 Gene: FBgn0037493 Transcript: FBtr0081579
Sequence length	270
Comment	pep:known chromosome:BDGP5:3R:3097314:3098231:1 gene:FBgn0037493 transcript:FBtr0081579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MRTFSIARGLNCLNFSQVCDGLADCKDCSDEDGTLCTAFRCLYGACVSPNALCNHIPDCL DGSDEMAEKDVKNAWKVCRLEDPSKSLVVENYVGGTTFQSTAFVPDKTVVHLSCRNGYAL IGEEKNICDQDQCRYPLSWCVPQCKHVGNLSHTRQCTLNGRPIDCDQSVLPMGTLMSVTC SSGYEKTGGDGLQFCDETGSWRGHKPEFTVVCHATIVSPYILVATEICFRNVAIKSVAST EPLFYTYNSFLAHEPHPFKLHNVSHIHYVT
Download sequence
Identical sequences	FBpp0081098 FBpp0081098 7227.FBpp0081098 FBpp0081098

SEARCH