SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081317 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081317
Domain Number 1 Region: 183-427
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.48e-64
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.00072
Further Details:      
 
Domain Number 2 Region: 468-789
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.18e-39
Family Extended AAA-ATPase domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081317   Gene: FBgn0014861   Transcript: FBtr0081827
Sequence length 887
Comment pep:known chromosome:BDGP5:3R:4090565:4093653:1 gene:FBgn0014861 transcript:FBtr0081827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNPSSPPPNTPSDAAERRDLRAAMTSPVGDFEPFENEDEILGDQTVRDEAEEEDGEELF
GDNMENDYRPMPELDHYDPALLDDEDDFSEMSQGDRFAAESEMRRRDRAAGIHRDDRDLG
FGQSDDEDDVGPRAKRRAGEKAAVGEVEDTEMVESIENLEDTKGHSTKEWVSMLGPRTEI
ANRFQSFLRTFVDERGAYTYRDRIRRMCEQNMSSFVVSYTDLANKEHVLAYFLPEAPFQM
LEIFDKVAKDMVLSIFPTYERVTTEIHVRISELPLIEELRTFRKLHLNQLVRTLGVVTAT
TGVLPQLSVIKYDCVKCGYVLGPFVQSQNTEIKPGSCPECQSTGPFSINMEQTLYRNYQK
ITLQESPGRIPAGRIPRSKDVILLADLCDQCKPGDELEVTGIYTNNYDGSLNTDQGFPVF
ATVIIANHVVVKDSKQVVQSLTDEDIATIQKLSKDPRIVERVVASMAPSIYGHDYIKRAL
ALALFGGESKNPGEKHKVRGDINLLICGDPGTAKSQFLKYTEKVAPRAVFTTGQGASAVG
LTAYVRRNPVSREWTLEAGALVLADQGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAG
IVTSLQARCTVIAAANPIGGRYDPSMTFSENVNLSEPILSRFDVLCVVKDEFDPMQDQQL
AKFVVHSHMKHHPSEEEQPELEEPQLKTVDEIPQDLLRQYIVYAKENIRPKLTNIDEDKI
AKMYAQLRQESFATGSLPITVRHIESVIRMSEAHARMHLRENVMEADVSMAIRMMLESFI
EAQKFSVMKKMRSTFQKYLSFQKDHSELLFFILRQLTLDQLAYIRCKDGPGATHVEIMER
DLIERAKQLDIVNLKPFYESDLFRTNGFSYDPKRRIILQIVVDGNTA
Download sequence
Identical sequences P49735
7227.FBpp0081317 7299005___KOG0477 FBpp0081317 FR595 FBpp0081317 NP_477121.1.81976 FBpp0081317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]