SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0081367 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081367
Domain Number 1 Region: 6-89
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.22e-23
Family Canonical RBD 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081367   Gene: FBgn0037602   Transcript: FBtr0081878
Sequence length 91
Comment pep:known chromosome:BDGP5:3R:4476806:4477215:1 gene:FBgn0037602 transcript:FBtr0081878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGFVRSSYKLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQ
RDAFNSASNQNTHFLDGRVLTVQRANESPQS
Download sequence
Identical sequences B4HL43 B4QY06 Q9VHP3
FBpp0081367 FBpp0081367 NP_649808.1.81976 XP_002032021.1.34323 XP_002104240.1.80810 7227.FBpp0081367 FBpp0205222 FBpp0216958 FBpp0081367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]