SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081459 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0081459
Domain Number - Region: 45-265
Classification Level Classification E-value
Superfamily NHL repeat 0.000288
Family NHL repeat 0.023
Further Details:      
 
Domain Number - Region: 475-545,575-640
Classification Level Classification E-value
Superfamily HCP-like 0.0471
Family HCP-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081459   Gene: FBgn0261241   Transcript: FBtr0081979
Sequence length 833
Comment pep:known chromosome:BDGP5:3R:5092754:5095958:1 gene:FBgn0261241 transcript:FBtr0081979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIMYNTGEWFKVRPDYYRKVELATPDWPLDLDLEYMWVEVAPYGGPLAVTRDPTKLVPV
KGNARPMIRIFDTTGREMGHILWNHGKLIAMGWSDMEELICIQENATVFVYDMFGREKES
YSIGDEASVTKIVEGKVFQSSAGTGVAVMTTSGRVFLKQNSSKTERKLPDIPNSSMNCSC
WEIVTEGRNSYCLLGRDREVIKLFPGETVGTITANLFEKPHERIIKISVSYNHQHLALYT
NTGLLWLGSVDMRQKYCEFDTGRKDMPLQMEWIMNSDNSEADAVVISYPSYLLIVNRNAD
RSDFPYDPVMFLVAEMDGVRIITQSSHEIIQRLPKCVENIFAVNSQEPASYLFEAQKKFE
EKSYKSDEYLSMCREKIDLAVSECIEAASYEFCPETQKSLLRTAYFGKGFIRNHNPDEYM
RIMRILRVLNTLRHERIAMPITFKQFSHLNTEVILSRLVFRKHYAIAIQVAKHLNLPESW
ILEHWAYHKVMNDPNDTEVARKITEKFKNPSVEGISFCNIASKAHQAGRDDLAIKLLELE
SRASLHVPLLLKMRKFDRAVGSATQSGDTELITQVLLEMKMHMMLSNLHMTIRDHPLALN
IYKKIMRESNRAGLYGIYNTEDDQKAIAEYHFQNAIETEGLESNLSMIGNAYAQGRCTLE
AELCADTSRLIKLQKTLSTKYNVSLNGLSIHETIQELLLIGELKEAERIRSEFKVPDRRF
WWLRILTLSSQHKWEELEKLAKSKKSPIGYDPFVEVCLKQDNVMEARKYIPRCRDNRRVV
WYMRANLFNEAIDSAFEQRDVHSLFELQKNQAIVNNGTLLSKVCDCIAMLEGK
Download sequence
Identical sequences Q9VHG1
FBpp0081459 NP_649877.1.81976 7227.FBpp0081459 FBpp0081459 FBpp0081459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]