SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081597 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081597
Domain Number 1 Region: 569-710
Classification Level Classification E-value
Superfamily PH domain-like 2.73e-45
Family Phosphotyrosine-binding domain (PTB) 0.0000229
Further Details:      
 
Domain Number 2 Region: 454-563
Classification Level Classification E-value
Superfamily SH2 domain 3.77e-22
Family SH2 domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081597   Gene: FBgn0000244   Transcript: FBtr0082119
Sequence length 720
Comment pep:known chromosome:BDGP5:3R:5353960:5358734:-1 gene:FBgn0000244 transcript:FBtr0082119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTPYEESAAAADHKYQYQYTAANNNNNYYKNYNVNGNGQANGNGNLSGIGNGNGIGNGN
GYGIPYHARENSLPFSYGIAKTSTPLRKTPTPTRVDSFLDFDFGPTNTNVNSNSSSNNGG
TGDMIKPPTRLTSPLLVRKTLGNAVSPTSSTNTNTIANTYHYTSSSATPTPVRDNFEQLL
RERREKVYNEYRNLDRESSGERARVAPAPPQRQYYPSDGYGIGLKNDSNGTLYRKSPSSN
GKSTKYNYDFEFNLNLDDVRPEPTPYTTRNIHFEDLRLDQDVPDGVVNRRTMERNYHTIN
SLETTHKRQQLEPLEQLGAVYGQNHMEETLTRTRRDLSASTSTSKSTSPLPAIGVPAIAP
ASPIYATSTKRVSNPNTNGQQQMTPSPTSRPETPAFPVTPRTPFGASSSSSASLAPTTQL
PPESIYQTGPRRGVPPALQPLEVSADSVQFARSSSQFWYKPNLTREDAIALLASAQPGTF
LVRDSTTYKDSYGLVVRVSQPPPGSQELVRHFLIEPTKGGVHLKGCDDEPVFTSLSALVF
EHSISQLALPCLLRLPDRDIVPPVRATTPAQQHLLAHGAATNVLWLYSCDTESLTGNEAI
RKAIRQMYGQQPLPQPTEVHFKVSSQGITLTDNTRKKFFRKHYKADVISHCAIDPENRMW
TSEGESDKKTIFAFVARRSHSSTDNQCHVFCDLSVSQPAAAIVSFANRTLPTEKLRNYVL
Download sequence
Identical sequences Q9VHC3
FBpp0081597 FBpp0081597 FBpp0290315 FBpp0291577 7227.FBpp0081597 NP_001163569.1.81976 NP_001163570.1.81976 NP_649901.1.81976 FBpp0081597 FBpp0290315 FBpp0291577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]