SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081871 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081871
Domain Number 1 Region: 98-182
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000375
Family V set domains (antibody variable domain-like) 0.064
Further Details:      
 
Domain Number 2 Region: 194-280
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000167
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081871   Gene: FBgn0037908   Transcript: FBtr0082395
Sequence length 336
Comment pep:known chromosome:BDGP5:3R:7326792:7331677:1 gene:FBgn0037908 transcript:FBtr0082395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWRHAVRATFTSTTATESSPLIGKVISNSRAPQIAHEMLVEYFMALLVIMGLTAPVDKQ
SRRSSQYFGHLAAAEELSNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDR
AVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEP
KISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLWHKDTELVSDSA
RGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNSNSDSVFVHIIKSEQHAAMQHELG
SRLLLPPLPLLLLAVLLVVLLGPTSSLQIRTPLSTR
Download sequence
Identical sequences Q961T8
FBpp0081871 7227.FBpp0081870 FBpp0081870 NP_650080.3.81976 FBpp0081870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]