SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0081902 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081902
Domain Number 1 Region: 218-316
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.62e-16
Family Canonical RBD 0.0011
Further Details:      
 
Domain Number 2 Region: 390-423
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000011
Family Ran binding protein zinc finger-like 0.0033
Further Details:      
 
Domain Number 3 Region: 340-367
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000165
Family Ran binding protein zinc finger-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081902   Gene: FBgn0037939   Transcript: FBtr0082426
Sequence length 446
Comment pep:known chromosome:BDGP5:3R:7526336:7528442:1 gene:FBgn0037939 transcript:FBtr0082426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTSASVVYTNSFYAPNYSDTQQPQPQLQTQQQMFHANYIVGTTLGSGLGFNFAPAPIP
QASAASGLSPRGMYSDLYRYEDGSGDASGSLLLVQEDDHFCGAEADQQLVASTSSSCPMA
SSGESVSIDTEQEAERDLQMNQCETLEREELNGDIGEMGEMEELAEEVNGEQRPPLLPCM
GGNTSYMVFPRTAADYMPRLALPRHRPYISIGQEQYVIQAETVFVLGMRLNVTKNDIILF
FGKVGVIKMDESTNKPKIFVYKNKITGRSKGEATITYVSPFSAQAAISCLSGAKFMGQVI
TVLPAYLSTRRGSVRYSYPRELNAPEHQRRQRAMKWKPAIDNWVCMLCRNSNFVWRSSCN
RCQADKVVAPQNNEGSSWAGSREEDGAPRRWRPYRNDWLCKICYNMNFWYRAKCNRCHAL
RSDEMKSSESTEEDTWELVLNPPIAE
Download sequence
Identical sequences Q9VGJ3
FBpp0081902 FBpp0081902 NP_650107.1.81976 7227.FBpp0081902 FBpp0081902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]