SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082316 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082316
Domain Number 1 Region: 107-224
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.2e-27
Family Canonical RBD 0.00018
Further Details:      
 
Domain Number 2 Region: 20-108
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.51e-24
Family Canonical RBD 0.0000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082316   Gene: FBgn0004237   Transcript: FBtr0082851
Sequence length 385
Comment pep:known chromosome:BDGP5:3R:9483046:9486241:-1 gene:FBgn0004237 transcript:FBtr0082851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQNDSNGNYDDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPK
TKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVG
GLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSI
KNKTLDVKKAIAKQDMDRQGGGGGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGG
AGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSN
GSWGGNGGGGGGGGGFGNEYQQSYGGGPQRNSNFGNNRPAPYSQGGGGGGFNKGNQGGGQ
GFAGNNYNTGGGGQGGNMGGGNRRY
Download sequence
Identical sequences E1JIK0 P48810
FBpp0082316 FBpp0289817 FBpp0302741 7227.FBpp0289817 NP_001163602.1.81976 NP_001262538.1.81976 NP_476806.2.81976 NP_476807.1.81976 FBpp0082316 FBpp0082316 FBpp0289817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]