SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082542 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082542
Domain Number 1 Region: 116-396
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.12e-70
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000756
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082542   Gene: FBgn0021750   Transcript: FBtr0083086
Sequence length 417
Comment pep:known chromosome:BDGP5:3R:11166407:11167939:1 gene:FBgn0021750 transcript:FBtr0083086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLPTNSQLWRPLLLLRRQRSHDAKAVEAPIHRPVPTSAQLDELERNVVVRHHKNNVPLI
RSLIQELDAGDQHKLRQLQAELEQLPNATHPRLRDYGEEPRELAQYVHRQLTPQSRLKEF
SELARALNLYRMDHLGNYTGHKSYYLTGQLATLEQAIIQYALQAVTEHGFKLISVPDILP
KEVIESCGMRTEGERTQVYKLDTGECLSGTSEMALAGFFANKLLSEDQLPLKVTAVSRCY
RAETSGLQEEKGIYRVHQFNKVEMFAICTEEQSEAELEEFKNIEVDLFRRLGLNFRLLDM
PPCELGAPAYQKYDIEAWMPGRQMWGEISSCSNCTDYQARRLGIRYRRSADGQILHAHTI
NGTATAIPRLLIALLESYQKEDGIEIPAVLRPFMDNQELITRNKRIPETKLVKFIKA
Download sequence
Identical sequences Q9VF85
NP_001262599.1.81976 NP_524365.1.81976 7300003___KOG2509 FBpp0082542 FBpp0082542 7227.FBpp0082542 FBpp0082542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]