SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082647 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082647
Domain Number 1 Region: 171-378
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.71e-29
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 431-629,704-794
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.26e-19
Family Extended AAA-ATPase domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082647   Gene: FBgn0003227   Transcript: FBtr0083193
Sequence length 885
Comment pep:known chromosome:BDGP5:3R:11648709:11658354:-1 gene:FBgn0003227 transcript:FBtr0083193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPTLSRGGAPSRFVRGRGRGGGAYRPYFYFRRNGRVIPAGGNRQPNQGEPGAPDAPSVP
PATRQPRGWSRTAGKRGRNAHLDCSFLRPENYAAPEDGLQVQSIAVDNPRAYSGWRLYFL
REKYEEGNELATRIMAVEAYYQRNPHTFDFVMIRDRGFFPLCAAGIKSDAQLKEVWPSLS
EDIREHPLRTLGTLSLAMHTVVVNHQLDCNDSTTAMVSTPEQYVLPTPRVRKIYARPDDF
VPVESIEGISHSRVDTLFSIRGFVSNVGEPSYSLTWQAFRCSRCQMEIAMRQRGTFQPRP
YQCKRSECVARDEFVPLRSSPYTRLSIRQIIRVEESSLNLVHDFETSMPAEMDVELRHDL
VDAVRVGQEVVVTGILKLQELGDDTTTGDTSNQMQPYLKAVSIRDASSIKREFSERDLEA
IVMINAEPNSFKLLVQSIAPEVYGHELPKAACLLSLLGGKGAETEAINVLLVGDPGIGKT
KILQSCAQIAERGAHVSGKRGAQSAQQLGVTFAGRNKRVLQAGSLMMASGGGHCTLDDVD
KLASKQAVLLQCLQSEEVNLPLAGAFASFPAQPSVIACANPQRGQYDEGRYLLQNINISP
SLLREFHLVYILLDKPSERDMSLTAHVRALHAGARKRARIAARYALKPKMSDSMCEVSLN
VPAAGKDDDTIKTEDDNDSIMQQDYDLDKRLEVLPEEGDLDLLPPILIKKFLSYARQELN
PVLNEDASNAVLRYFLELKGSCNLDEDVSSQIGAGQLLAIIHLSQARARLDLSHVVSPQH
VRDVIALLTESITQTSLKEGSSRQGTRGGGGAGGGAGKSAQLRNFLELTKRRSAALGRRI
FEFDELKEIGTRAGILTGFSQLVEMANLGGYLLMKGANMYEVVPD
Download sequence
Identical sequences A0A0B4KH79 Q9VF30
NP_001262615.1.81976 NP_732072.1.81976 FR563 7227.FBpp0082647 FBpp0082647 FBpp0082647 FBpp0082647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]