SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082724 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082724
Domain Number 1 Region: 5-185
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.91e-36
Family Canonical RBD 0.0000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082724   Gene: FBgn0040284   Transcript: FBtr0083272
Sequence length 255
Comment pep:known chromosome:BDGP5:3R:12165849:12167706:-1 gene:FBgn0040284 transcript:FBtr0083272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRNECRIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDA
VKARDGYDYDGYRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYRVMVT
GLPASGSWQDLKDHMREAGDVCFADTYKDGSGVVEFLRHEDMKYAIKKLDDSRFRSHEGE
VAYIRVREDSGDNDRGGGGGGSGGGGGGSGGGGSRDYRDRSRSRSFSSRPRRRGTPTYSP
VRRQSYSRSRSRSNY
Download sequence
Identical sequences B3P110 B4IBX5 Q9V3W7
7227.FBpp0082724 FBpp0082724 FBpp0196921 NP_001247139.1.81976 NP_652611.1.81976 XP_001980171.1.56816 XP_002041235.1.34323 XP_016034429.1.80810 FBpp0082724 FBpp0082724 FBpp0293269 FBpp0138605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]