SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082776 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082776
Domain Number 1 Region: 3-82,114-169
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.88e-17
Family Galectin (animal S-lectin) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082776   Gene: FBgn0038419   Transcript: FBtr0083326
Sequence length 179
Comment pep:known chromosome:BDGP5:3R:12171855:12174946:-1 gene:FBgn0038419 transcript:FBtr0083326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDVKFFAVLPTNASTSDRVTRLSISGNLLQDPQQFSVNFVNSPDCTDNITYHFKVVIPT
QTIIENYKRNGEWSSLHQEKYLNIFDGTGASDKNPNMTESFARIITEIDEALQLSSTESS
FCLEFAFDYANSMMRVYQGRDSGHNFITEYETLFSLSDIQAVQVWGDVQKVNQFALSYN
Download sequence
Identical sequences Q9VEW5
NP_001262629.1.81976 NP_001287363.1.81976 NP_732131.1.81976 FBpp0082775 7227.FBpp0082775 FBpp0082775 FBpp0082776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]