SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082818 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082818
Domain Number 1 Region: 82-239
Classification Level Classification E-value
Superfamily TPR-like 1.23e-18
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082818   Gene: FBgn0038462   Transcript: FBtr0083375
Sequence length 282
Comment pep:known chromosome:BDGP5:3R:12820258:12821810:-1 gene:FBgn0038462 transcript:FBtr0083375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLDYEKMSWSDVRDQFRTWREETGRHSEEVVQLWVAVLEDKVHKTGNERHLILEQVIIA
ALDTARFDIATKCTKQLSLEFPGSLRVMKFKAMRYEALEQYDEADEVLDAIIAKDETNAA
PRKRKIAILKARGRRLEAIKELNEYLKKFMSDQEAWHELCNMYLAEGEFGKAAFCMEEVL
LHNPHSHLIHQRLAEIRYTMGGVENMESARTYYSQALKLNPHNLRALYGIYLCCNHLDNS
RAVSSKRKELQKLSQWALEQLLTKQTIVPLEAAFGNLEIKSN
Download sequence
Identical sequences Q9VEQ1
FBpp0082818 NP_001262652.1.81976 NP_650581.1.81976 FBpp0082818 7227.FBpp0082818 FR693 FBpp0082818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]