SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0082961 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082961
Domain Number 1 Region: 431-542
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000038
Family Canonical RBD 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082961   Gene: FBgn0000363   Transcript: FBtr0083537
Sequence length 616
Comment pep:known chromosome:BDGP5:3R:13769829:13841501:1 gene:FBgn0000363 transcript:FBtr0083537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKIANYQDLLGSHHQLLIAATAAAAAAAAAEPQLQLQHLLPAAPTTPAVISNPINSIGP
INQISSSSHPSNNNQQAVFEKAITISSIAIKRRPTLPQTPASAPQVLSPSPKRQCAAAVS
VLPVTVPVPVPVSVPLPVSVPVPVSVKGHPISHTHQIAHTHQISHSHPISHPHHHQLSFA
HPTQFAAAVAAHHQQQQQQQAQQQQQAVQQQQQQAVQQQQVAYAVAASPQLQQQQQQQQH
RLAQFNQAAAAALLNQHLQQQHQAQQQQHQAQQQSLAHYGGYQLHRYAPQQQQQHILLSS
GSSSSKHNSNNNSNTSAGAASAAVPIATSVAAVPTTGGSLPDSPAHESHSHESNSATASA
PTTPSPAGSVTSAAPTATATAAAAGSAAATAAATGTPATSAVSDSNNNLNSSSSSNSNSN
AIMENQMALAPLGLSQSMDSVNTASNEEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGS
LLKVTSKNGKTASPVGFVTFHTRAGAEAAKQDLQQGVRFDPDMPQTIRLEFAKSNTKVSK
PKPQPNTATTASHPALMHPLTGHLGGPFFPGGPELWHHPLAYSAAAAAELPGAAALQHAT
LVHPALHPQVPVRSYL
Download sequence
Identical sequences FBpp0289475 FBpp0082961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]