SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083050 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0083050
Domain Number - Region: 159-204
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0373
Family LDL receptor-like module 0.0071
Further Details:      
 
Domain Number - Region: 122-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0432
Family LDL receptor-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083050   Gene: FBgn0038619   Transcript: FBtr0083630
Sequence length 213
Comment pep:known chromosome:BDGP5:3R:14230732:14231724:1 gene:FBgn0038619 transcript:FBtr0083630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKTWVKRENIYFKPFYKQKSKMFLLLIFLVGISFIAYQAFSLNQLPGVPAPWNLQQIKR
KHQQMMQSLGSKQRDVDDFDGGGADAVAPAGGETSPVAGHEDPIKIVRGTRLFDYDAYKP
NFEGKFRCLDGSKEIPFDHLNDNYCDCEEDGSDEPSTNACAKGRFYCRYQKRHITGRGLD
IYVASSRINDHVCDCCDGSDEWSTATKCPNDCA
Download sequence
Identical sequences Q9VE71
7227.FBpp0083050 FBpp0083050 NP_650724.1.81976 FBpp0083050 FBpp0083050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]