SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083898 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083898
Domain Number 1 Region: 193-508
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.15e-84
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000512
Further Details:      
 
Domain Number 2 Region: 1222-1489
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.13e-72
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000115
Further Details:      
 
Domain Number 3 Region: 510-714
Classification Level Classification E-value
Superfamily Ribosomal protein L25-like 1.88e-44
Family Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain 0.0011
Further Details:      
 
Domain Number 4 Region: 1492-1622
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.8e-30
Family Anticodon-binding domain of Class II aaRS 0.0001
Further Details:      
 
Domain Number 5 Region: 1625-1714
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 3.53e-17
Family C-terminal domain of ProRS 0.0065
Further Details:      
 
Domain Number 6 Region: 819-872
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 2.35e-16
Family a tRNA synthase domain 0.00046
Further Details:      
 
Domain Number 7 Region: 746-798
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 5.1e-16
Family a tRNA synthase domain 0.00048
Further Details:      
 
Domain Number 8 Region: 891-944
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.00000000000000165
Family a tRNA synthase domain 0.00054
Further Details:      
 
Domain Number 9 Region: 55-160
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000000139
Family Glutathione S-transferase (GST), C-terminal domain 0.021
Further Details:      
 
Domain Number 10 Region: 1047-1097
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.0000000000000161
Family a tRNA synthase domain 0.001
Further Details:      
 
Domain Number 11 Region: 971-1023
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.000000000000051
Family a tRNA synthase domain 0.00065
Further Details:      
 
Domain Number 12 Region: 1122-1170
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.000000000000706
Family a tRNA synthase domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083898   Gene: FBgn0005674   Transcript: FBtr0084511
Sequence length 1714
Comment pep:known chromosome:BDGP5:3R:19777852:19784117:-1 gene:FBgn0005674 transcript:FBtr0084511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIKLKANLNNPPISGLATAHLINGTVPVEIVWSKEETSLQFPDNRLLVCHSNNDVLRAL
ARAAPDYKLYGETAIERTQIDHWLSFSLTCEDDISWALSFLDKSIAPVTYLVANKLTIAD
FALFNEMHSRYEFLAAKGIPQHVQRWYDLITAQPLIQKVLQSLPEDAKVKRSPQSSKEQT
PAKTGERKQEGKFVDLPGAEMGKVVVRFPPEASGYLHIGHAKAALLNQYYALAFQGTLIM
RFDDTNPAKETVEFENVILGDLEQLQIKPDVFTHTSNYFDLMLDYCVRLIKESKAYVDDT
PPEQMKLEREQRVESANRSNSVEKNLSLWEEMVKGSEKGQKYCVRAKIDMSSPNGCMRDP
TIYRCKNEPHPRTGTKYKVYPTYDFACPIVDAIENVTHTLRTTEYHDRDDQFYWFIDALK
LRKPYIWSYSRLNMTNTVLSKRKLTWFVDSGLVDGWDDPRFPTVRGIIRRGMTVEGLKEF
IIAQGSSKSVVFMNWDKIWAFNKKVIDPIAPRYTALEKEKRVIVNVAGAKVERIQVSVHP
KDESLGKKTVLLGPRIYIDYVDAEALKEGENATFINWGNILIRKVNKDASGNITSVDAAL
NLENKDFKKTLKLTWLAVEDDPSAYPPTFCVYFDNIISKAVLGKDEDFKQFIGHKTRDEV
PMLGDPELKKCKKGDIIQLQRRGFFKVDVAYAPPSGYTNVPSPIVLFSIPDGHTKDVPTS
GLKVNAPDAKATKKASSPVSSSGQASELDSQISQQGDLVRDLKSKKAAKDQIDVAVKKLL
ALKADYKSATGKDWKPGQTSASSAPVPAASSSSANDAVSVNASIVKQGDLVRDLKGKKAS
KPEIDAAVKTLLELKAQYKTLTGQDWKPGTVPTTAAPSASAAPSVGVNDSVAQILSQITA
QGDKVRELKSAKADKATVDAAVKTLLSLKADYKAATGSDWKPGTTAPAPAAAPVKVKQEK
NPDPASVLTVNTLLNKIAQQGDKIRQLKSAKSEKSLVEAEVKLLLALKTDYKSLTGQEWK
PGTVAPAPTTVNVIDLTGGDSGSDVGSVLSKIQAQGDKIRKLKSEKAAKNVIDPEVKTLL
ALKGEYKTLSGKDWTPDAKSEPAVVKKEASPVSMASPAKDELTQEINAQGEKVRAAKGNK
AAKEVIDAEVAKLLALKAKYKEVTGTDFPVAGRGGGGGGGSAKKAPKEAQPKPAKPVKKE
PAADASGAVKKQTRLGLEATKEDNLPDWYSQVITKGEMIEYYDVSGCYILRQWSFAIWKA
IKTWFDAEITRMGVKECYFPIFVSKAVLEKEKTHIADFAPEVAWVTKSGDSDLAEPIAVR
PTSETVMYPAYAKWVQSYRDLPIRLNQWNNVVRWEFKQPTPFLRTREFLWQEGHTAFADK
EEAAKEVLDILDLYALVYTHLLAIPVVKGRKTEKEKFAGGDYTTTVEAFISASGRAIQGA
TSHHLGQNFSKMFEIVYEDPETQQKKYVYQNSWGITTRTIGVMIMVHADNQGLVLPPHVA
CIQAIVVPCGITVNTKDDERAQLLDACKALEKRLVGGGVRCEGDYRDNYSPGWKFNHWEL
KGVPLRLEVGPKDLKAQQLVAVRRDTVEKITIPLADVEKKIPALLETIHESMLNKAQEDM
TSHTKKVTNWTDFCGFLEQKNILLAPFCGEISCEDKIKADSARGEEAEPGAPAMGAKSLC
IPFDQPAPIAASDKCINPSCTNKPKFYTLFGRSY
Download sequence
Identical sequences P28668
FBpp0083898 FBpp0083898 FBpp0083898 7227.FBpp0083898 NP_524471.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]