SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083968 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083968
Domain Number 1 Region: 213-433
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.27e-20
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0018
Further Details:      
 
Domain Number 2 Region: 42-156
Classification Level Classification E-value
Superfamily tRNA-binding arm 4.18e-16
Family Seryl-tRNA synthetase (SerRS) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083968   Gene: FBgn0051133   Transcript: FBtr0084583
Sequence length 464
Comment pep:known chromosome:BDGP5:3R:19973158:19974645:-1 gene:FBgn0051133 transcript:FBtr0084583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSLRSVLKHCLSAKKTCSRNISALYITGDKANENYVTLQPYMDFNKTFGERQFLEQSIS
SRGLDIRLETVLSKYEKYKTHHAQLSKVAEERERVTKRLKELTKSGSSAVQLEELKEHGK
SLRNELKALKQTLYPIEDDFIHDYLHLPNLLHVQCPVGGEEKLLYRHGIPKSENKTTSHL
ARQELVHFVDNNRYYLMEQAALFDVNAMQSLARYFVNHGHFIQTANPDFVRCVLLEANAT
PLSDYHLVQEEHLQNKINTAYLTGGASFESYLGAMTKLCVYPSVLPLRYVCCGRSYNRAE
ADLYGPIPSLYTATQTNAVQIFVATQTDNEADSQLEHILNLATDFYKALDIPFRISYATA
ADLTPAESIRAVIEVYAPSLQRYVCVGRISNYGDFVSKRILFSTRREKHYDFLHMVGGPV
LYTSRLIAALVEHGVRLEDCKLLGSISQKPVHQQDLQQFKDLFT
Download sequence
Identical sequences Q95T19
FBpp0083968 FBpp0083968 NP_732958.1.81976 7227.FBpp0083968 FBpp0083968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]