SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084021 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084021
Domain Number 1 Region: 369-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.02e-47
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00068
Further Details:      
 
Domain Number 2 Region: 305-376
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 3.39e-18
Family Domains B1 and B5 of PheRS-beta, PheT 0.012
Further Details:      
 
Domain Number 3 Region: 5-90
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000128
Family Domains B1 and B5 of PheRS-beta, PheT 0.0093
Further Details:      
 
Domain Number 4 Region: 108-269
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000238
Family B3/B4 domain of PheRS, PheT 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084021   Gene: FBgn0039175   Transcript: FBtr0084637
Sequence length 589
Comment pep:known chromosome:BDGP5:3R:20076182:20078380:-1 gene:FBgn0039175 transcript:FBtr0084637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTIGVKRDLLFEALGKTYTDDEFQDLCFAFGLELDEVTTEKQMLTKEQGDVAAAANASE
EIIYRIDIPANRYDLLCLEGLVTGLLVFQGKLKPPKFQFVELAKRQVLKIDPSTAQIRPY
AVAAVLRNVTFTQASYNSFIDLQDKLHQNICRKRTLVAIGTHDLDTLQGPFSYEALAPDQ
IKFKPLNQTKEMTGSELMDFYSTHAQLKQYLPIIRESPVYPVIYDANRVVLSLPPIINGD
HSKITLKTKNVFIECTATDRTKAKVVLDTIVCLFSEHCAQKFTVEPCDVVQPDGSVISYP
ELEVREERISVKRANAYIGIDEPAEKLADMLTRMYLEAKVDGDSLVVKIPPTRHDVIHAC
DIYEDVAIAYGYNNIKKSLPAFMQIAKQFPLNKLTEQLREQVAQAGFTEALTFTLCSRDD
IGRKLNKNIDALPAVHIGNPKTLEFQVVRTTLLPGLLKTLVANRKMPLPLKLFEISDVVV
ADESTEVGARNERRVCAVNCNKTAGFEVVHGLLDRVMQLLSVPWKSASGTKGYYLQATED
PSYFPGRCANVMYDGVVIGKIGVLHPTVLQAFELTTPCSAVEFTIEPFV
Download sequence
Identical sequences Q9VCA5
FBpp0084021 NP_651237.1.81976 7301135___KOG2472 7227.FBpp0084021 FBpp0084021 FBpp0084021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]