SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084180 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0084180
Domain Number - Region: 741-783
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000373
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084180   Gene: FBgn0039290   Transcript: FBtr0084805
Sequence length 993
Comment pep:known chromosome:BDGP5:3R:21025540:21039371:1 gene:FBgn0039290 transcript:FBtr0084805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNSLASHRLFQTGETRGVTITCRNTMIQILTHRPNFSPLVVFMLLLVDHRLIVDSSVPV
LQNPSEEYTKYVPIEELKLPEDQELVVRLPSNSLLKYTSYKDVSILHFDVPPDSRTAYFT
FKAFEDPKSAFQRKCKPKDVTLHLKASSYPVISPENITFPKNFFTKDQRFKVYDLQFLSD
EQQQRITIEGPYIGNWFAVAFVSWSDPNNDRIEQQGLAASCDTLLSAEMSVSRFRPIIIN
NGQEHEDNLTSHVLPELNGANITKDALNTSRPLRSIPPKQQKLKVASKSLAEGKSSRAAQ
FANTTENHNSTPTANNEIIYRFYVPDDIGDATARIMFDQVCDECPPVGFHVRANGYPLGG
TDHNHGHGTIIRPNQTTEISIQFGVQPNSWHYALLTFVNEADESEMHSQANNSHTNHSLS
YVLQIDYITEDSDNAMQKSKTVQNSTNSSSANPWEPTKFRRMNFYSLLRQTYREFFMFDY
DLRPDVNGTVPETLNLTAKTHSGFAFDLGQVSDIGGTLTFALSMKEAHRASLKMSLPTQP
PDLGGILAERLIGDPKEEVVPAVSATSNQSMQIVVCMQLGEPGEPEYPDKCRYGQRLMQA
SIIVNNTESMGLVHVPFPESGRWYVTMGLFCHGSGTARVSIMESVKEFIRKHQDMLADMR
SPCDCAESVARYTSCLQSPDCLEAMNETETLKVKECIMDDKCSTNFKQMTRLFVEHHKAA
MEQHVAVENCNTSVVFSVSSSPCVAGRCGRFGRCYHYMSGGFVFSTCVCSKGYRGWDCTE
DSQVPTNMSILLATLLLTLSNLLFFPSIYMAVKRRYYTEGVIYFFAMFFSIFYHACDAGE
DEYSFCLVKIGVLQFCDFYCGLLSIWVTLVAMAHVRTELVSLLHMFGAILLAFGTELNKQ
SLWVFLAPALTGICLISTSWGLRCAKSRKLFPSRRYLSVWLPFGLTLVVAGLVCYAFLQT
KQNYHIVHSIWHMVMALSILCLLPSRKSFLPKC
Download sequence
Identical sequences Q9VBW1
NP_651350.2.81976 FBpp0084180 FBpp0084180 7227.FBpp0084180 FBpp0084180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]