SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0084255 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084255
Domain Number 1 Region: 288-375
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.72e-24
Family Canonical RBD 0.0000748
Further Details:      
 
Domain Number 2 Region: 202-287
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.42e-22
Family Canonical RBD 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084255   Gene: FBgn0011666   Transcript: FBtr0084881
Sequence length 634
Comment pep:known chromosome:BDGP5:3R:21344045:21426858:1 gene:FBgn0011666 transcript:FBtr0084881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFENPAVAAKLPFPYNVPPPLQAAAAAAAAVPNLRFQTPIKAFACLTAATRSVSEMNAT
SLYAGNPMENAAAAAAAAAAGLIDPHHNRDLHQALVASIANNSVAAIGGGLTTAAVLKSA
AQQSQQAVQQNQNAVVVTPGLEQPKQEPAQQAALALLKENVNASAGAGQNNGQAAMGGSN
KSGSSGRSTPSLSGGSGSDPAPGKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVT
QRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPKNRPRQANKTKKIFVGGVSQ
DTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKK
VECKKAQPKEAVTPAAQLLQKRIMLGTLGVQLPTAPGQLIGARGAGVATMNPLAMLQNPT
QLLQSPAAAAAAQQAALISQNPFQVQNAAAAASIANQAGFGKLLTTYPQTALHSVRYAPY
SIPASAATANAALMQAHQAQSVAAAAHHHQQQQQQQHHHQQQTHNAHVAAAQQQQQSHHN
AVSNPASQAHSAAAAAALAANAANGAGAAGAHSLAAAAQQAGLMAGNPLNAAAAAAAAAA
NPAAAYSNYALANVDMSSFQGVDWSTMYGMGMYV
Download sequence
Identical sequences Q8IMS8
FBpp0084255 FBpp0293748 FBpp0305820 NP_001247303.1.81976 NP_001262960.1.81976 NP_733108.2.81976 FBpp0084255 FBpp0084255 7227.FBpp0084255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]