SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084460 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084460
Domain Number 1 Region: 175-251
Classification Level Classification E-value
Superfamily Homeodomain-like 1.8e-23
Family Homeodomain 0.00066
Further Details:      
 
Weak hits

Sequence:  FBpp0084460
Domain Number - Region: 115-161
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0732
Family beta-sandwich domain of Sec23/24 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084460   Gene: FBgn0003267   Transcript: FBtr0085090
Sequence length 350
Comment pep:known chromosome:BDGP5:3R:22702545:22706893:-1 gene:FBgn0003267 transcript:FBtr0085090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRHKVEIGSPDGSPGIKRSDSLDPIANTTILSVPQRPSSPRQFFERLYGHLETRSSENG
EIDVGTHAHKPPPCDTPYHSDGGSVSSPDISISDERTSLAAYPAYDFYGHAKDYPQHPSQ
QHQQHHHHHHHPPQLVHQKLSYVSPPPAIAAGGAANPVLPHAFPAGFPSDPHFSAGFSAF
LARRRRKEGRQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQ
NRRAKDKRIEKAQIDQHYRNFVVANGFMSSIMGQAATTMPPGGVTGGVAVGVGLNYYAAA
ATPAALPKDNTQDANFIDIDDQFQRQQQQKQQQQQQQQRRRETTTPINIC
Download sequence
Identical sequences P10181
NP_524521.1.81976 NP_733173.1.81976 FBpp0084460 FBpp0084461 7227.FBpp0084461 FBpp0084460 FBpp0084460 FBpp0084461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]